anti-Ratte (Rattus) ATP6AP2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended ATP6AP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) Antikörper
  • APT6M8-9
  • ATP6IP2
  • ATP6M8-9
  • ELDF10
  • M8-9
  • MRXE
  • MSTP009
  • XMRE
  • (P)RR
  • 5730403E06Rik
  • Atp6ip2
  • tj6
  • wss
  • arcl
  • j6b7
  • stv1
  • tj6m
  • tj6s
  • vph1
  • atp6a2
  • atp6n1d
  • ATP6AP2
  • DKFZp459G0918
  • atp6ap2
  • wu:fj36c03
  • wu:fq15e04
  • zgc:73194
  • ATPase H+ transporting accessory protein 2
  • ATPase, H+ transporting, lysosomal accessory protein 2
  • ATPase H+ transporting V0 subunit d2
  • ATPase H+ transporting V0 subunit a2
  • ATPase, H+ transporting, lysosomal accessory protein 2 S homeolog
  • ATP6AP2
  • Atp6ap2
  • ATP6V0D2
  • atp6v0a2
  • atp6ap2.S
  • atp6ap2
Reaktivität
Human, Maus, Ratte (Rattus)
110
48
44
6
4
4
4
1
1
1
1
1
1
Wirt
Kaninchen
92
20
1
Klonalität
Polyklonal
Konjugat
Dieser ATP6AP2 Antikörper ist unkonjugiert
7
7
6
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
88
55
35
16
13
10
6
6
4
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Bilder

Produktnummer ABIN4349995
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.958844 ABIN250031 IHC (p) IHC ELISA WB Goat C-Term Anmelden zum Anzeigen Polyclonal 8
4 ABIN872738 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN5958331 ELISA IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5552900 EIA IHC (p) WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN884094 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN884089 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(110), (48), (44), (6), (4), (4), (4), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(92), (20), (1)
Klonalität
Polyklonal
Konjugat Dieser ATP6AP2 Antikörper ist unkonjugiert
(7), (7), (6), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(88), (55), (35), (16), (13), (10), (6), (6), (4), (1), (1), (1)
Pubmed 7 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ATP6AP2 Antikörper

Target Details ATP6AP2 Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Isotyp IgG
Plasmids, Primers & others

Target Details ATP6AP2

Produktdetails anti-ATP6AP2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben
Antigen
Andere Bezeichnung Renin R (ATP6AP2 Antibody Abstract)
Hintergrund Gene Symbol: ATP6AP2
Gen-ID 10159
Pathways ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones

Anwendungsinformationen

Produktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995)

Produktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Kirsch, Schrezenmeier, Klare, Zaade, Seidel, Schmitz, Bernhard, Lauer, Slack, Goldin-Lang, Unger, Zollmann, Funke-Kaiser: "The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein." in: International journal of molecular medicine, Vol. 33, Issue 4, pp. 795-808, 2014

Rosendahl, Niemann, Lange, Ahadzadeh, Krebs, Contrepas, van Goor, Wiech, Bader, Schwake, Peters, Stahl, Nguyen, Wenzel: "Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 94, Issue 8, pp. 863-72, 2014 (Probematerial (Species): Mouse (Murine)). Weitere Details: Western Blotting

Gonzalez, Green, Luffman, Bourgeois, Gabriel Navar, Prieto: "Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension." in: American journal of physiology. Renal physiology, Vol. 307, Issue 8, pp. F962-70, 2014 (Probematerial (Species): Rat (Rattus)). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence

Gonzalez, Womack, Liu, Seth, Prieto: "Angiotensin II increases the expression of (pro)renin receptor during low-salt conditions." in: The American journal of the medical sciences, Vol. 348, Issue 5, pp. 416-22, 2014 (Probematerial (Species): Rat (Rattus)). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence

Zaade, Schmitz, Benke, Klare, Seidel, Kirsch, Goldin-Lang, Zollmann, Unger, Funke-Kaiser: "Distinct signal transduction pathways downstream of the (P)RR revealed by microarray and ChIP-chip analyses." in: PLoS ONE, Vol. 8, Issue 3, pp. e57674, 2013

Prieto, Williams, Liu, Kavanagh, Mullins, Mitchell: "Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension." in: American journal of physiology. Renal physiology, Vol. 300, Issue 2, pp. F581-8, 2011

Gonzalez, Lara, Luffman, Seth, Prieto: "Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats." in: Hypertension (Dallas, Tex. : 1979), Vol. 57, Issue 4, pp. 859-64, 2011

Bilder

Produktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin receptor Antibody [NBP1-90820] - Staining of hum...
Immunofluorescence (IF) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunocytochemistry/Immunofluorescence: Renin R Antibody [NBP1-90820] - Staining of h...
Western Blotting (WB) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Western Blot: Renin receptor Antibody [NBP1-90820] - Lane 1: Marker [kDa] 250, 130, 9...
Western Blotting (WB) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Western Blot: Renin receptor Antibody [NBP1-90820] - Lane 1: NIH-3T3 cell lysate (Mou...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining of human cerebellum shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining of human pancreas shows p...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining in human cerebral cortex ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining of human cerebral cortex ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining of human placenta shows p...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) antibody (ABIN4349995) Immunohistochemistry-Paraffin: Renin R Antibody - Staining of human renal cancer sho...