Produkt kostenlos erhalten?
Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validierenRelevance Score | ABIN | Application | Konjugat | Host | Isotype | Epitope | Hersteller | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|---|
11.157918 | ABIN250031 | IHC (p) IHC ELISA WB | Goat | C-Term | Anmelden zum Anzeigen | Polyclonal | 8 | |||
4 | ABIN872738 | IF (p) IHC (p) WB | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | |||
4 | ABIN5958331 | ELISA IF IHC (p) WB | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | |||
1 | ABIN5552900 | EIA IHC (p) WB | Goat | C-Term | Anmelden zum Anzeigen | Polyclonal | 0 | |||
1 | ABIN884094 | IHC (p) WB | HRP | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | ||
1 | ABIN884089 | IHC (p) WB | Biotin | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 |
General |
|
---|---|
Antigen | ATPase, H+ Transporting, Lysosomal Accessory Protein 2 (ATP6AP2) Antikörper |
Reaktivität | Human, Maus, Ratte (Rattus) Alternativen |
Wirt | Kaninchen Alternativen |
Klonalität | |
Konjugat | Dieser ATP6AP2 Antikörper ist unkonjugiert Alternativen |
Applikation |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternativen
|
![]() |
7 Publikationen vorhanden |
Hersteller | Anmelden zum Anzeigen |
Produktdetails anti-ATP6AP2 AntikörperTarget Details ATP6AP2 Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder |
|
Spezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Reinigung | Immunogen affinity purified |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN |
Isotyp | IgG |
Plasmids, Primers & others | |
Target Details ATP6AP2Produktdetails anti-ATP6AP2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben |
|
Antigen | |
Andere Bezeichnung | Renin R (ATP6AP2 Antibody Abstract) |
Hintergrund | Gene Symbol: ATP6AP2 |
Gen-ID | 10159 |
Pathways | ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones |
AnwendungsinformationenProduktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben |
|
Applikations-hinweise | Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. |
Kommentare |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
Beschränkungen | Nur für Forschungszwecke einsetzbar |
HandhabungProduktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) Bilder zurück nach oben |
|
Format | Liquid |
Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
Konservierungs-mittel | Sodium azide |
Vorsichtsmaßnahmen | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Lagerung | 4 °C,-20 °C |
Informationen zur Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995)Produktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Handhabung Bilder zurück nach oben |
|
Produkt verwendet in: |
Kirsch, Schrezenmeier, Klare, Zaade, Seidel, Schmitz, Bernhard, Lauer, Slack, Goldin-Lang, Unger, Zollmann, Funke-Kaiser: "The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein." in: International journal of molecular medicine, Vol. 33, Issue 4, pp. 795-808, 2014 Rosendahl, Niemann, Lange, Ahadzadeh, Krebs, Contrepas, van Goor, Wiech, Bader, Schwake, Peters, Stahl, Nguyen, Wenzel: "Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 94, Issue 8, pp. 863-72, 2014 (Probematerial (Species): Mouse (Murine)). Weitere Details: Western Blotting Gonzalez, Green, Luffman, Bourgeois, Gabriel Navar, Prieto: "Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension." in: American journal of physiology. Renal physiology, Vol. 307, Issue 8, pp. F962-70, 2014 (Probematerial (Species): Rat (Rattus)). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence Gonzalez, Womack, Liu, Seth, Prieto: "Angiotensin II increases the expression of (pro)renin receptor during low-salt conditions." in: The American journal of the medical sciences, Vol. 348, Issue 5, pp. 416-22, 2014 (Probematerial (Species): Rat (Rattus)). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence Zaade, Schmitz, Benke, Klare, Seidel, Kirsch, Goldin-Lang, Zollmann, Unger, Funke-Kaiser: "Distinct signal transduction pathways downstream of the (P)RR revealed by microarray and ChIP-chip analyses." in: PLoS ONE, Vol. 8, Issue 3, pp. e57674, 2013 Prieto, Williams, Liu, Kavanagh, Mullins, Mitchell: "Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension." in: American journal of physiology. Renal physiology, Vol. 300, Issue 2, pp. F581-8, 2011 Gonzalez, Lara, Luffman, Seth, Prieto: "Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats." in: Hypertension (Dallas, Tex. : 1979), Vol. 57, Issue 4, pp. 859-64, 2011 |
BilderProduktdetails anti-ATP6AP2 Antikörper Target Details ATP6AP2 Anwendungsinformationen Handhabung Referenzen für anti-ATP6AP2 Antikörper (ABIN4349995) zurück nach oben |
|
Bilder des Herstellers |
|