anti-Human PLCB3 Antikörper für Immunofluorescence

Recommended PLCB3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
phospholipase C, beta 3 (Phosphatidylinositol-Specific) (PLCB3) Antikörper
  • she
  • Plcbeta3
  • wu:fl04b08
  • si:zc188c22.1
  • si:ch211-188c22.1
  • plcb3
  • PLCB3
  • mKIAA4098
  • phospholipase C, beta 3 (phosphatidylinositol-specific)
  • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3
  • phospholipase C, beta 3
  • PLCB3
  • Plcb3
  • plcb3
Reaktivität
Human
88
79
79
Wirt
Kaninchen
91
Klonalität
Polyklonal
Konjugat
Dieser PLCB3 Antikörper ist unkonjugiert
3
3
3
3
3
3
3
3
3
3
3
3
3
3
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
42
39
23
23
22
7
4
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4346116
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.326117 ABIN4346115 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3186501 ELISA IF IHC WB Rabbit IgG Thr236 Anmelden zum Anzeigen Polyclonal
1 ABIN498225 IF IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2891986 IF IHC (p) Rabbit Leu532 Anmelden zum Anzeigen Polyclonal
1 ABIN4346114 ICC IF IHC IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN5585782 IF IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2149228 IF IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal

Ähnliche anti-PLCB3 Antikörper

Applikation / Reaktivität Human
ELISA 22 Antikörper
Immunocytochemistry (ICC) 4 Antikörper
Immunofluorescence (IF) 8 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 39 Antikörper
Immunohistochemistry (IHC) 23 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 24 Antikörper
Immunoprecipitation (IP) 1 Antikörper
Western Blotting (WB) 40 Antikörper

General

Antigen phospholipase C, beta 3 (Phosphatidylinositol-Specific) (PLCB3) Antikörper
Reaktivität Human
(88), (79), (79)
Wirt Kaninchen
(91)
Klonalität
Polyklonal
Konjugat Dieser PLCB3 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(42), (39), (23), (23), (22), (7), (4), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PLCB3 Antikörper

Target Details PLCB3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADR
Isotyp IgG

Target Details PLCB3

Produktdetails anti-PLCB3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PLC-beta 3 (PLCB3 Antibody Abstract)
Hintergrund Gene Symbol: PLCB3
Gen-ID 5331
UniProt Q01970
Pathways WNT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, CXCR4-mediated Signaling Events, G-protein mediated Events

Anwendungsinformationen

Produktdetails anti-PLCB3 Antikörper Target Details PLCB3 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PLCB3 Antikörper Target Details PLCB3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PLCB3 Antikörper Target Details PLCB3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-PLCB3 Antikörper (phospholipase C, beta 3 (Phosphatidylinositol-Specific)) (ABIN4346116) Immunohistochemistry: Phospholipase C beta 3 Antibody [NBP2-32026] - Immunohistochemi...
Western Blotting (WB) image for anti-PLCB3 Antikörper (phospholipase C, beta 3 (Phosphatidylinositol-Specific)) (ABIN4346116) Western Blot: Phospholipase C beta 3 Antibody [NBP2-32026] - Lane 1: Marker [kDa] 250...
Immunofluorescence (IF) image for anti-PLCB3 Antikörper (phospholipase C, beta 3 (Phosphatidylinositol-Specific)) (ABIN4346116) Immunocytochemistry/Immunofluorescence: Phospholipase C beta 3 Antibody [NBP2-32026] ...
Western Blotting (WB) image for anti-PLCB3 Antikörper (phospholipase C, beta 3 (Phosphatidylinositol-Specific)) (ABIN4346116) Western Blot: Phospholipase C beta 3 Antibody [NBP2-32026] - Lane 1: Marker [kDa] 250...