anti-Human Phospholipase C beta 2 Antikörper für Immunocytochemistry

Recommended Phospholipase C beta 2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
phospholipase C beta 2 (PLCb2) Antikörper
  • AI550384
  • B230205M18Rik
  • B230399N12
  • phospholipase C, beta 2
  • Plcb2
  • PLCB2
Reaktivität
Human
45
27
26
Wirt
Kaninchen
44
3
Klonalität
Polyklonal
Konjugat
Dieser Phospholipase C beta 2 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
28
13
13
9
7
7
5
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5078805
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5014108 ICC IHC IP WB Rabbit IgG AA 1-250 Anmelden zum Anzeigen Polyclonal

General

Antigen phospholipase C beta 2 (PLCb2) Antikörper
Reaktivität Human
(45), (27), (26)
Wirt Kaninchen
(44), (3)
Klonalität
Polyklonal
Konjugat Dieser Phospholipase C beta 2 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(28), (13), (13), (9), (7), (7), (5), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Phospholipase C beta 2 Antikörper

Target Details Phospholipase C beta 2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL
Isotyp IgG

Target Details Phospholipase C beta 2

Produktdetails anti-Phospholipase C beta 2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Phospholipase C beta 2 (PLCb2 Antibody Abstract)
Hintergrund Gene Symbol: PLCB2
Gen-ID 5330
Pathways WNT Signalweg, Thyroid Hormone Synthesis, CXCR4-mediated Signaling Events, G-protein mediated Events, Thromboxane A2 Receptor Signaling

Anwendungsinformationen

Produktdetails anti-Phospholipase C beta 2 Antikörper Target Details Phospholipase C beta 2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Phospholipase C beta 2 Antikörper Target Details Phospholipase C beta 2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-Phospholipase C beta 2 Antikörper Target Details Phospholipase C beta 2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-phospholipase C beta 2 (PLCb2) antibody (ABIN5078805) Immunocytochemistry/Immunofluorescence: Phospholipase C beta 2 Antibody - Staining o...