anti-Human FRZB Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended FRZB Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Frizzled-Related Protein (FRZB) Antikörper
  • Frp
  • Sfrp3
  • frezzled
  • fritz
  • frzb-1
  • FRE
  • FRITZ
  • FRP-3
  • FRZB-1
  • FRZB-PEN
  • FRZB1
  • FZRB
  • OS1
  • SFRP3
  • SRFP3
  • hFIZ
  • Frzb-1
  • frizzled-related protein
  • Frzb
  • FRZB
Reaktivität
Human
64
15
10
4
3
3
3
3
2
2
2
1
1
1
Wirt
Kaninchen
34
27
4
1
1
Klonalität
Polyklonal
Konjugat
Dieser FRZB Antikörper ist unkonjugiert
4
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
64
26
12
3
2
1
1
1
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4893950
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN958985 IHC (p) WB Rabbit AA 216-265 Anmelden zum Anzeigen Polyclonal
1 ABIN4353137 IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN1868040 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Frizzled-Related Protein (FRZB) Antikörper
Reaktivität Human
(64), (15), (10), (4), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(34), (27), (4), (1), (1)
Klonalität
Polyklonal
Konjugat Dieser FRZB Antikörper ist unkonjugiert
(4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(64), (26), (12), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FRZB Antikörper

Target Details FRZB Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS.

Target Details FRZB

Produktdetails anti-FRZB Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung sFRP-3/FRZB (FRZB Antibody Abstract)
Hintergrund Gene Symbol: FRZB
Molekulargewicht Theoretical MW: 36 kDa
Gen-ID 2487
NCBI Accession NP_001454
Pathways WNT Signalweg, Positive Regulation of fat Cell Differentiation

Anwendungsinformationen

Produktdetails anti-FRZB Antikörper Target Details FRZB Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against FRZB and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FRZB Antikörper Target Details FRZB Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-FRZB Antikörper Target Details FRZB Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Frizzled-Related Protein (FRZB) antibody (ABIN4893950) Immunohistochemistry-Paraffin: sFRP-3/FRZB Antibody [NBP1-79552] - Human spleen cell ...
Western Blotting (WB) image for anti-Frizzled-Related Protein (FRZB) antibody (ABIN4893950) Western Blot: sFRP-3/FRZB Antibody [NBP1-79552] - Titration: 0.2-1 ug/ml, Positive Co...
Western Blotting (WB) image for anti-Frizzled-Related Protein (FRZB) antibody (ABIN4893950) Western Blot: sFRP-3/FRZB Antibody [NBP1-79552] - Titration: 0.4 ug/ml Positive Contr...