anti-Maus VASP Antikörper für Immunofluorescence

Recommended VASP Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Vasodilator-Stimulated phosphoprotein (VASP) Antikörper
  • vasp
  • MGC80889
  • wu:fb23b04
  • wu:fk84g05
  • zgc:110347
  • si:dkey-113g17.1
  • si:ch211-202c21.1
  • DDBDRAFT_0188463
  • DDBDRAFT_0229340
  • DDB_0188463
  • DDB_0229340
  • VASP
  • vasodilator-stimulated phosphoprotein
  • Vasodilator-stimulated phosphoprotein
  • zgc:162320
  • vasp
  • AaeL_AAEL010747
  • CpipJ_CPIJ004706
  • CpipJ_CPIJ004707
  • vasP
  • VASP
  • zgc:162320
  • Vasp
Reaktivität
Human, Maus, Ratte (Rattus)
275
145
115
20
16
13
8
7
5
3
2
1
1
Wirt
Kaninchen
225
42
8
Klonalität
Polyklonal
Konjugat
Dieser VASP Antikörper ist unkonjugiert
7
6
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
246
118
67
50
47
34
27
17
15
11
5
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4364869
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN126908 EIA FACS IF IP WB Mouse IgG1 pSer157 Anmelden zum Anzeigen 5C6 1
1 ABIN197436 IF WB Rabbit Ser157 Anmelden zum Anzeigen Polyclonal 5
1 ABIN126907 FACS IF FITC Mouse IgG1 pSer157 Anmelden zum Anzeigen 5C6 1
1 ABIN126905 EIA FACS IF IP WB Biotin Mouse IgG1 pSer157 Anmelden zum Anzeigen 5C6 1
1 ABIN3187449 ELISA IF IHC WB Rabbit IgG Tyr272 Anmelden zum Anzeigen Polyclonal
1 ABIN3187452 ELISA IF IHC WB Rabbit IgG Tyr290 Anmelden zum Anzeigen Polyclonal
1 ABIN362856 IF WB Rabbit IgG AA 155-159 Anmelden zum Anzeigen Polyclonal 2
1 ABIN498590 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN126911 FACS IF FITC Mouse IgG1 pSer239 Anmelden zum Anzeigen 16C2
1 ABIN126909 EIA FACS IF IP WB Biotin Mouse IgG1 pSer239 Anmelden zum Anzeigen 16C2
1 ABIN126912 EIA FACS IF IP WB Mouse IgG1 pSer239 Anmelden zum Anzeigen 16C2
1 ABIN498589 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN1875310 FACS IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2892956 IF IHC (p) WB Rabbit His151 Anmelden zum Anzeigen Polyclonal
1 ABIN2892957 IF IHC (p) WB Rabbit Ala232 Anmelden zum Anzeigen Polyclonal
1 ABIN1842404 IF WB Rabbit IgG pSer157 Anmelden zum Anzeigen Polyclonal
1 ABIN2878486 FACS IF IHC IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1094590 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1094591 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN274059 IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Vasodilator-Stimulated phosphoprotein (VASP) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(275), (145), (115), (20), (16), (13), (8), (7), (5), (3), (2), (1), (1)
Wirt Kaninchen
(225), (42), (8)
Klonalität
Polyklonal
Konjugat Dieser VASP Antikörper ist unkonjugiert
(7), (6), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(246), (118), (67), (50), (47), (34), (27), (17), (15), (11), (5), (4), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-VASP Antikörper

Target Details VASP Anwendungsinformationen Handhabung Referenzen für anti-VASP Antikörper (ABIN4364869) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Isotyp IgG

Target Details VASP

Produktdetails anti-VASP Antikörper Anwendungsinformationen Handhabung Referenzen für anti-VASP Antikörper (ABIN4364869) Bilder zurück nach oben
Antigen
Andere Bezeichnung VASP (VASP Antibody Abstract)
Hintergrund Gene Symbol: VASP
Gen-ID 7408
Forschungsgebiet Signaling, Extracellular Matrix
Pathways T-Zell Rezeptor Signalweg, Regulation of Actin Filament Polymerization, Tube Formation

Anwendungsinformationen

Produktdetails anti-VASP Antikörper Target Details VASP Handhabung Referenzen für anti-VASP Antikörper (ABIN4364869) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000-1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-VASP Antikörper Target Details VASP Anwendungsinformationen Referenzen für anti-VASP Antikörper (ABIN4364869) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-VASP Antikörper (ABIN4364869)

Produktdetails anti-VASP Antikörper Target Details VASP Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Stadler, Hjelmare, Neumann, Jonasson, Pepperkok, Uhlén, Lundberg: "Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy." in: Journal of proteomics, Vol. 75, Issue 7, pp. 2236-51, 2012

Bilder

Produktdetails anti-VASP Antikörper Target Details VASP Anwendungsinformationen Handhabung Referenzen für anti-VASP Antikörper (ABIN4364869) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Vasodilator-Stimulated phosphoprotein (VASP) antibody (ABIN4364869) Western Blot: VASP Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line ...
Western Blotting (WB) image for anti-Vasodilator-Stimulated phosphoprotein (VASP) antibody (ABIN4364869) Western Blot: VASP Antibody - Analysis in human cell line HELA.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Vasodilator-Stimulated phosphoprotein (VASP) antibody (ABIN4364869) Immunohistochemistry-Paraffin: VASP Antibody - Staining of human small intestine sho...
Immunofluorescence (IF) image for anti-Vasodilator-Stimulated phosphoprotein (VASP) antibody (ABIN4364869) Immunocytochemistry/Immunofluorescence: VASP Antibody - Immunofluorescent staining o...