anti-Human MAP4K1 Antikörper für Immunohistochemistry

Recommended MAP4K1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1) Antikörper
  • HPK1
  • Hpk1
  • mHPK1
  • mitogen activated protein kinase kinase kinase kinase 1
  • mitogen-activated protein kinase kinase kinase kinase 1
  • Map4k1
  • MAP4K1
Reaktivität
Human
133
35
26
8
8
7
3
2
1
1
1
1
Wirt
Kaninchen
105
18
10
Klonalität
Polyklonal
Konjugat
Dieser MAP4K1 Antikörper ist unkonjugiert
8
8
8
7
7
7
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
74
71
33
22
19
14
10
4
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4332661
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.134318 ABIN2431867 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.134318 ABIN2426441 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN441042 IHC IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911816 IHC ELISA WB FITC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911814 IHC ELISA WB APC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911817 IHC ELISA WB PE Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911813 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911818 IHC ELISA WB HRP Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1911815 IHC ELISA WB Biotin Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4904297 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2471667 IP IHC WB Mouse IgG1 lambda Anmelden zum Anzeigen 2A1
1 ABIN2587056 ELISA IHC WB Rabbit IgG pThr165 Anmelden zum Anzeigen Polyclonal
1 ABIN2307154 IHC ELISA WB PE Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307155 IP IHC ELISA WB Mouse IgG Mix lambda Anmelden zum Anzeigen 2A1
1 ABIN2307152 IHC ELISA WB FITC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307138 IHC ELISA WB APC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307136 IHC ELISA WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307153 IHC ELISA WB HRP Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307151 IHC ELISA WB Biotin Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2307137 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal

General

Antigen Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1) Antikörper
Reaktivität Human
(133), (35), (26), (8), (8), (7), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(105), (18), (10)
Klonalität
Polyklonal
Konjugat Dieser MAP4K1 Antikörper ist unkonjugiert
(8), (8), (8), (7), (7), (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(74), (71), (33), (22), (19), (14), (10), (4)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MAP4K1 Antikörper

Target Details MAP4K1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS
Isotyp IgG

Target Details MAP4K1

Produktdetails anti-MAP4K1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MAP4K1 (MAP4K1 Antibody Abstract)
Hintergrund Gene Symbol: MAP4K1
Gen-ID 11184
Forschungsgebiet Signaling
Pathways T-Zell Rezeptor Signalweg, Signaling of Hepatocyte Growth Factor Receptor

Anwendungsinformationen

Produktdetails anti-MAP4K1 Antikörper Target Details MAP4K1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MAP4K1 Antikörper Target Details MAP4K1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-MAP4K1 Antikörper Target Details MAP4K1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1) antibody (ABIN4332661) Immunohistochemistry: MAP4K1 Antibody [NBP1-83221] - Immunohistochemical staining of ...