anti-Human Zinc Finger Protein 354A Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Zinc Finger Protein 354A Antibody (geliefert von: Anmelden zum Anzeigen )

Zinc Finger Protein 354A (ZNF354A) Antikörper
  • ZNF354A
  • MGC143044
  • EZNF
  • HKL1
  • KID-1
  • KID1
  • TCF17
  • ZNF354B
  • AW488485
  • Tcf17
  • Znf354a
  • kid1
  • Kid1
  • zinc finger protein 354A
  • ZNF354A
  • Zfp354a
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4367188
Preis und Verfügbarkeit auf Anfrage.


Antigen Zinc Finger Protein 354A (ZNF354A) Antikörper
Reaktivität Human
(12), (7), (7), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(8), (4)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(11), (3), (2), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSAT HKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung ZNF354A (ZNF354A Antibody Abstract)
Hintergrund Gene Symbol: ZNF354A
Gen-ID 6940
Forschungsgebiet Transcription Factors, Chromatin and Nuclear Signaling
Pathways Sensory Perception of Sound


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Zinc Finger Protein 354A (ZNF354A) antibody (ABIN4367188) Immunocytochemistry/Immunofluorescence: ZNF354A Antibody - Immunofluorescent stainin...