anti-Human Tricellulin Antikörper für Immunofluorescence

Recommended Tricellulin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Tricellulin (MARVELD2) Antikörper
  • Mrvldc2
  • BC003296
  • MARVD2
  • Tric
  • Trica
  • Tricb
  • Tricc
  • DFNB49
  • MRVLDC2
  • MARVEL domain containing 2
  • MARVEL (membrane-associating) domain containing 2
  • Marveld2
  • MARVELD2
Reaktivität
Human
30
10
9
4
3
3
3
1
1
1
1
Wirt
Kaninchen
30
Klonalität
Polyklonal
Konjugat
Dieser Tricellulin Antikörper ist unkonjugiert
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
27
11
10
6
3
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5077988
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN261710 ICC IHC (fro) IF IP IHC WB Rabbit AA 90-140 Anmelden zum Anzeigen Polyclonal 2
1 ABIN598197 IF IP WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2387772 IF IP WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal

General

Antigen Tricellulin (MARVELD2) Antikörper
Reaktivität Human
(30), (10), (9), (4), (3), (3), (3), (1), (1), (1), (1)
Wirt Kaninchen
(30)
Klonalität
Polyklonal
Konjugat Dieser Tricellulin Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(27), (11), (10), (6), (3), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Tricellulin Antikörper

Target Details Tricellulin Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDY
Isotyp IgG

Target Details Tricellulin

Produktdetails anti-Tricellulin Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MARVELD2 (MARVELD2 Antibody Abstract)
Hintergrund Gene Symbol: MARVELD2
Gen-ID 153562
Forschungsgebiet Signaling
Pathways Sensory Perception of Sound, Cell-Cell Junction Organization

Anwendungsinformationen

Produktdetails anti-Tricellulin Antikörper Target Details Tricellulin Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Tricellulin Antikörper Target Details Tricellulin Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-Tricellulin Antikörper Target Details Tricellulin Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Tricellulin (MARVELD2) antibody (ABIN5077988) Immunocytochemistry/Immunofluorescence: MARVELD2 Antibody - Staining of human cell l...