anti-Human TIMM8B Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended TIMM8B Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Translocase of Inner Mitochondrial Membrane 8 Homolog B (Yeast) (TIMM8B) Antikörper
  • DDP2
  • TIM8B
  • Ddp2
  • Tim8b
  • translocase of inner mitochondrial membrane 8 homolog B (yeast)
  • translocase of inner mitochondrial membrane 8 homolog b (yeast)
  • translocase of inner mitochondrial membrane 8B
  • TIMM8B
  • Timm8b
Reaktivität
Human
5
Wirt
Kaninchen
5
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
5
5
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN4359787
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Translocase of Inner Mitochondrial Membrane 8 Homolog B (Yeast) (TIMM8B) Antikörper
Reaktivität Human
(5)
Wirt Kaninchen
(5)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(5), (5)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TIMM8B Antikörper

Target Details TIMM8B Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
Isotyp IgG

Target Details TIMM8B

Produktdetails anti-TIMM8B Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TIMM8B (TIMM8B Antibody Abstract)
Hintergrund Gene Symbol: TIMM8B
Gen-ID 26521
Forschungsgebiet Signaling
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-TIMM8B Antikörper Target Details TIMM8B Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TIMM8B Antikörper Target Details TIMM8B Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.