anti-Human Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) Antikörper für Immunofluorescence

Recommended Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) Antibody (geliefert von: Anmelden zum Anzeigen )

Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) (TIMM13) Antikörper
  • fd44h11
  • zgc:92895
  • wu:fd44h11
  • TIMM13
  • T25B24.8
  • T25B24_8
  • translocase of the inner mitochondrial membrane 13
  • D10Ertd378e
  • Tim9
  • Timm9
  • TIM13
  • TIM13B
  • TIMM13A
  • TIMM13B
  • ppv1
  • translocase of inner mitochondrial membrane 13 homolog (yeast)
  • mitochondrial import inner membrane translocase subunit Tim13
  • Mitochondrial inner membrane translocase
  • translocase of inner mitochondrial membrane 13
  • timm13
  • TIMM13
  • TIM13
  • Timm13
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4359776
Preis und Verfügbarkeit auf Anfrage.


Antigen Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) (TIMM13) Antikörper
Reaktivität Human
(10), (7), (5), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(8), (4)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(11), (7)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKC IGKPGGSLDNSEQKCIAMCMDRYMD
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung TIMM13 (TIMM13 Antibody Abstract)
Hintergrund Gene Symbol: TIMM13
Gen-ID 26517
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:250 - 1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) (TIMM13) antibody (ABIN4359776) Immunocytochemistry/Immunofluorescence: TIMM13 Antibody - Staining of human cell lin...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Translocase of Inner Mitochondrial Membrane 13 Homolog (Yeast) (TIMM13) antibody (ABIN4359776) Immunohistochemistry-Paraffin: TIMM13 Antibody - Staining of human stomach shows str...