anti-Human TIMM10 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended TIMM10 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Translocase of Inner Mitochondrial Membrane 10 Homolog (Yeast) (TIMM10) Antikörper
  • Tim13
  • Timm13a
  • TIM10
  • TIM10A
  • Tim10
  • zgc:86900
  • translocase of inner mitochondrial membrane 10
  • translocase of inner mitochondrial membrane 10 homolog (yeast)
  • Timm10
  • TIMM10
  • timm10
Reaktivität
Human
12
8
8
2
2
2
1
1
Wirt
Kaninchen
12
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
11
6
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4359773
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5589521 IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Translocase of Inner Mitochondrial Membrane 10 Homolog (Yeast) (TIMM10) Antikörper
Reaktivität Human
(12), (8), (8), (2), (2), (2), (1), (1)
Wirt Kaninchen
(12)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(11), (6), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TIMM10 Antikörper

Target Details TIMM10 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Isotyp IgG

Target Details TIMM10

Produktdetails anti-TIMM10 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TIMM10 (TIMM10 Antibody Abstract)
Hintergrund Gene Symbol: TIMM10
Gen-ID 26519
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-TIMM10 Antikörper Target Details TIMM10 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TIMM10 Antikörper Target Details TIMM10 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-TIMM10 Antikörper Target Details TIMM10 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Translocase of Inner Mitochondrial Membrane 10 Homolog (Yeast) (TIMM10) antibody (ABIN4359773) Immunocytochemistry/Immunofluorescence: TIMM10 Antibody - Immunofluorescent staining...