anti-Human Solute Carrier Family 26, Member 5 (Prestin) Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Solute Carrier Family 26, Member 5 (Prestin) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5) Antikörper
  • pres
  • fb73d12
  • fb74g12
  • wu:fb73d12
  • wu:fb74g12
  • DFNB61
  • PRES
  • Pres
  • prestin
  • solute carrier family 26, member 5
  • solute carrier family 26, member 5 (prestin)
  • solute carrier family 26 (anion exchanger), member 5
  • slc26a5
  • SLC26A5
  • Slc26a5
Reaktivität
Human
28
10
10
5
3
2
2
2
2
2
1
Wirt
Kaninchen
15
11
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
22
13
7
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4354205
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN320862 IHC (p) WB Rabbit IgG AA 351-400 Anmelden zum Anzeigen Polyclonal
1 ABIN748718 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5) Antikörper
Reaktivität Human
(28), (10), (10), (5), (3), (2), (2), (2), (2), (2), (1)
Wirt Kaninchen
(15), (11), (3)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(22), (13), (7), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Protein A purified
Immunogen Synthetic peptides corresponding to SLC26A5(solute carrier family 26, member 5 (prestin)) The peptide sequence was selected from the middle region of SLC26A5. Peptide sequence FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS.

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SLC26A5 (SLC26A5 Antibody Abstract)
Hintergrund Gene Symbol: SLC26A5
Molekulargewicht Theoretical MW: 81 kDa
Gen-ID 375611
UniProt P58743
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound, Dicarboxylic Acid Transport

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against SLC26A5 and was validated on Western Blot and immunohistochemistry-paraffin The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5) antibody (ABIN4354205) Western Blot: SLC26A5 Antibody [NBP1-59791] - Titration: 2.5 ug/ml Positive Control: ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5) antibody (ABIN4354205) Immunohistochemistry-Paraffin: SLC26A5 Antibody [NBP1-59791] - Human Lung Alveolar ce...