anti-Human SLC12A2 Antikörper für Immunocytochemistry

Recommended SLC12A2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) Antikörper
  • BSC
  • BSC2
  • NKCC1
  • Bsc2
  • Nkcc1
  • bsc2
  • 9330166H04Rik
  • mBSC2
  • sy-ns
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 2
  • solute carrier family 12 (sodium/potassium/chloride transporter), member 2
  • solute carrier family 12, member 2
  • SLC12A2
  • Slc12a2
Reaktivität
Human
100
28
27
15
14
9
7
7
3
3
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
50
35
17
3
Klonalität
Polyklonal
Konjugat
Dieser SLC12A2 Antikörper ist unkonjugiert
3
3
3
3
3
3
3
2
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
42
33
31
27
25
4
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5078383
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) Antikörper
Reaktivität Human
(100), (28), (27), (15), (14), (9), (7), (7), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(50), (35), (17), (3)
Klonalität
Polyklonal
Konjugat Dieser SLC12A2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(42), (33), (31), (27), (25), (4), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SLC12A2 Antikörper

Target Details SLC12A2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI
Isotyp IgG

Target Details SLC12A2

Produktdetails anti-SLC12A2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung NKCC1/SLC12A2 (SLC12A2 Antibody Abstract)
Hintergrund Gene Symbol: SLC12A2
Gen-ID 6558
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-SLC12A2 Antikörper Target Details SLC12A2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SLC12A2 Antikörper Target Details SLC12A2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SLC12A2 Antikörper Target Details SLC12A2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) antibody (ABIN5078383) Immunocytochemistry/Immunofluorescence: NKCC1/SLC12A2 Antibody - Staining of human c...