anti-Maus SIX Homeobox 1 Antikörper für Immunohistochemistry

Recommended SIX Homeobox 1 Antibody (geliefert von: Anmelden zum Anzeigen )

SIX Homeobox 1 (SIX1) Antikörper
  • BB138287
  • BOS3
  • DFNA23
  • TIP39
  • XSix1
  • sine oculis-related homeobox 1
  • SIX homeobox 1
  • Six1
  • SIX1
  • six1
Human, Maus
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4894657
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2779599 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 2
1 ABIN2780732 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4353939 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 15
1 ABIN4244360 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen SIX Homeobox 1 (SIX1) Antikörper
Reaktivität Human, Maus
(35), (18), (8), (4), (4), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(26), (10)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(28), (15), (5), (5), (4), (3), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP.


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung SIX1 (SIX1 Antibody Abstract)
Hintergrund Gene Symbol: SIX1
Gen-ID 6495
NCBI Accession NP_033215
Forschungsgebiet Cell Cycle, Transcription Factors, Chromatin and Nuclear Signaling
Pathways Sensory Perception of Sound, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:1000, Immunohistochemistry 1 : 600This is a rabbit polyclonal antibody against Six1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-SIX Homeobox 1 (SIX1) antibody (ABIN4894657) Western Blot: SIX1 Antibody [NBP1-82401] - Mouse Kidney Lysate 1ug/ml Gel Concentrati...
Immunohistochemistry (IHC) image for anti-SIX Homeobox 1 (SIX1) antibody (ABIN4894657) Immunohistochemistry: SIX1 Antibody [NBP1-82401] - Human Adult heart Observed Stainin...