anti-Human SIX Homeobox 1 Antikörper für Immunohistochemistry

Recommended SIX Homeobox 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
SIX Homeobox 1 (SIX1) Antikörper
  • BB138287
  • BOS3
  • DFNA23
  • TIP39
  • XSix1
  • sine oculis-related homeobox 1
  • SIX homeobox 1
  • Six1
  • SIX1
  • six1
Reaktivität
Human, Maus
35
18
8
4
4
4
3
3
3
2
1
1
1
1
Wirt
Kaninchen
26
10
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
28
15
5
5
4
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4894657
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2779599 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 2
1 ABIN2780732 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4353939 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 15
1 ABIN4963893 ICC IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen CL0185
1 ABIN4244360 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen SIX Homeobox 1 (SIX1) Antikörper
Reaktivität Human, Maus
(35), (18), (8), (4), (4), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(26), (10)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(28), (15), (5), (5), (4), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP.

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SIX1 (SIX1 Antibody Abstract)
Hintergrund Gene Symbol: SIX1
Gen-ID 6495
NCBI Accession NP_033215
Forschungsgebiet Cell Cycle, Transcription Factors, Chromatin and Nuclear Signaling
Pathways Sensory Perception of Sound, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:1000, Immunohistochemistry 1 : 600This is a rabbit polyclonal antibody against Six1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-SIX Homeobox 1 (SIX1) antibody (ABIN4894657) Western Blot: SIX1 Antibody [NBP1-82401] - Mouse Kidney Lysate 1ug/ml Gel Concentrati...
Immunohistochemistry (IHC) image for anti-SIX Homeobox 1 (SIX1) antibody (ABIN4894657) Immunohistochemistry: SIX1 Antibody [NBP1-82401] - Human Adult heart Observed Stainin...