anti-Human SCO1 Cytochrome C Oxidase Assembly Protein Antikörper für Immunocytochemistry

Recommended SCO1 Cytochrome C Oxidase Assembly Protein Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) Antikörper
  • Bs
  • CD117
  • Fdc
  • Gsfsco1
  • Gsfsco5
  • Gsfsow3
  • SCO1
  • SCO5
  • SOW3
  • Ssm
  • Tr-kit
  • W
  • c-KIT
  • SCOD1
  • RGD1559538
  • kit oncogene
  • SCO cytochrome oxidase deficient homolog 1 (yeast)
  • SCO1 cytochrome c oxidase assembly protein
  • Kit
  • SCO1
  • Sco1
Reaktivität
Human
32
15
15
4
3
3
3
3
2
1
1
Wirt
Kaninchen
28
4
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
29
12
10
8
6
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4352258
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4352257 ELISA ICC IF IHC IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal
1 ABIN4352259 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) Antikörper
Reaktivität Human
(32), (15), (15), (4), (3), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(28), (4)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (12), (10), (8), (6), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung SCO1 (SCO1 Antibody Abstract)
Hintergrund Gene Symbol: SCO1
Gen-ID 6341
Forschungsgebiet Signaling, Metabolism, Organelles
Pathways Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Rolland, Motori, Memar, Hench, Frank, Winklhofer, Conradt: "Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 110, Issue 32, pp. E2967-76, 2013 (Probematerial (Species): Human). Weitere Details: Western Blotting

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Western Blot: SCO1 Antibody [NBP1-87073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Immunocytochemistry/Immunofluorescence: SCO1 Antibody [NBP1-87073] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human liver s...