anti-Hormone Parathyroid Hormone 2 Antikörper für Western Blotting

Recommended Parathyroid Hormone 2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Parathyroid Hormone 2 (PTH2) Antikörper
  • TIP39
  • Tifp39
  • Tip39
  • RGD1559447
  • BIT1
  • PTH2
  • BOS3
  • DFNA23
  • parathyroid hormone 2
  • peptidyl-tRNA hydrolase 2
  • SIX homeobox 1
  • PTH2
  • Pth2
  • PTRH2
  • SIX1
Epitop
Middle Region
5
1
1
Reaktivität
Hormone
11
5
5
3
3
2
2
2
1
1
Wirt
Kaninchen
11
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
7
6
4
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN636078
$ 473.93
Zzgl. Versandkosten $45.00

General

Antigen Parathyroid Hormone 2 (PTH2) Antikörper
Epitop Middle Region
(5), (1), (1)
Reaktivität Hormone
(11), (5), (5), (3), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(11)
Klonalität
Polyklonal
Applikation Western Blotting (WB)
(7), (6), (4), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität PTH2 antibody was raised against the middle region of PTH2
Reinigung Affinity purified
Immunogen PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PTH2 (PTH2 Antibody Abstract)
Substanzklasse Hormone
Hintergrund TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.
Molekulargewicht 11 kDa (MW of target protein)
Forschungsgebiet Hormones
Pathways Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Parathyroid Hormone 2 (PTH2) (Middle Region) antibody (ABIN636078) PTH2 antibody used at 1 ug/ml to detect target protein.