anti-Human NIPBL Antikörper für Immunohistochemistry

Recommended NIPBL Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Nipped-B Homolog (Drosophila) (NIPBL) Antikörper
  • SCC2W
  • scc2
  • nipbl
  • scc2-2
  • NIPBL
  • nipbla
  • wu:fi33d08
  • CDLS
  • CDLS1
  • IDN3
  • IDN3-B
  • Scc2
  • 4921518A06Rik
  • 4933421G18Rik
  • C79399
  • Idn3
  • Nipped-B homolog
  • nipped-B homolog
  • Nipped-B homolog (Drosophila)
  • nipped-b homolog b (Drosophila)
  • NIPBL
  • nipbl-b
  • nipblb
  • nipbl
  • Nipbl
Reaktivität
Human
45
37
20
6
5
3
2
1
1
1
1
Wirt
Kaninchen
24
20
9
2
Klonalität
Polyklonal
Konjugat
Dieser NIPBL Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC)
26
22
13
13
11
10
9
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4339767
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2607491 IF IHC IP WB Rat IgG1 Anmelden zum Anzeigen
1 ABIN2607492 IF IHC IP WB Rat IgG2b Anmelden zum Anzeigen
1 ABIN2252363 IF IP IHC WB Rat IgG1 Isoform A Anmelden zum Anzeigen 10K293
1 ABIN2564147 IHC ELISA Goat IgG AA 889-902 Anmelden zum Anzeigen Polyclonal

General

Antigen Nipped-B Homolog (Drosophila) (NIPBL) Antikörper
Reaktivität Human
(45), (37), (20), (6), (5), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(24), (20), (9), (2)
Klonalität
Polyklonal
Konjugat Dieser NIPBL Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC)
(26), (22), (13), (13), (11), (10), (9), (4), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-NIPBL Antikörper

Target Details NIPBL Anwendungsinformationen Handhabung Referenzen für anti-NIPBL Antikörper (ABIN4339767) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS
Isotyp IgG

Target Details NIPBL

Produktdetails anti-NIPBL Antikörper Anwendungsinformationen Handhabung Referenzen für anti-NIPBL Antikörper (ABIN4339767) Bilder zurück nach oben
Antigen
Andere Bezeichnung NIPBL (NIPBL Antibody Abstract)
Hintergrund Gene Symbol: NIPBL
Gen-ID 25836
Pathways Sensory Perception of Sound, Stem Cell Maintenance

Anwendungsinformationen

Produktdetails anti-NIPBL Antikörper Target Details NIPBL Handhabung Referenzen für anti-NIPBL Antikörper (ABIN4339767) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunofluorescence 1-4 μg/mLFor HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-NIPBL Antikörper Target Details NIPBL Anwendungsinformationen Referenzen für anti-NIPBL Antikörper (ABIN4339767) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-NIPBL Antikörper (ABIN4339767)

Produktdetails anti-NIPBL Antikörper Target Details NIPBL Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Xu, Ying, Shan, Feng, Zhang, Gao, Xu, Yao, Zhu, Mao: "Enhanced expression of cohesin loading factor NIPBL confers poor prognosis and chemotherapy resistance in non-small cell lung cancer." in: Journal of translational medicine, Vol. 13, pp. 153, 2015 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails anti-NIPBL Antikörper Target Details NIPBL Anwendungsinformationen Handhabung Referenzen für anti-NIPBL Antikörper (ABIN4339767) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Nipped-B Homolog (Drosophila) (NIPBL) antibody (ABIN4339767) Immunohistochemistry: NIPBL Antibody [NBP1-85110] - Staining of human thyroid gland s...
Immunohistochemistry (IHC) image for anti-Nipped-B Homolog (Drosophila) (NIPBL) antibody (ABIN4339767) Immunohistochemistry: NIPBL Antibody [NBP1-85110] - Staining of human small intestine...
Immunofluorescence (IF) image for anti-Nipped-B Homolog (Drosophila) (NIPBL) antibody (ABIN4339767) Immunofluorescence: NIPBL Antibody [NBP1-85110] - Staining of human cell line SiHa sh...
Immunofluorescence (IF) image for anti-Nipped-B Homolog (Drosophila) (NIPBL) antibody (ABIN4339767) Immunocytochemistry/Immunofluorescence: NIPBL Antibody - Immunofluorescent staining ...