anti-Human Norrie Disease (Pseudoglioma) Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Norrie Disease (Pseudoglioma) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Norrie Disease (Pseudoglioma) (NDP) Antikörper
  • EVR2
  • FEVR
  • ND
  • evr2
  • fevr
  • xnorrin
  • Ndph
  • RGD1563968
  • Norrie disease (pseudoglioma)
  • Norrie disease (pseudoglioma) (human)
  • NDP
  • ndp
  • Ndp
Reaktivität
Human
30
9
7
1
1
1
1
1
Wirt
Kaninchen
27
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
23
11
10
10
5
4
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4892212
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4340371 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5584295 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Norrie Disease (Pseudoglioma) (NDP) Antikörper
Reaktivität Human
(30), (9), (7), (1), (1), (1), (1), (1)
Wirt Kaninchen
(27), (4)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(23), (11), (10), (10), (5), (4), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV.

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Norrin/NDP (NDP Antibody Abstract)
Hintergrund Gene Symbol: NDP
Gen-ID 4693
UniProt Q00604
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 2-5 μg/mLThis is a rabbit polyclonal antibody against NDP and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Norrie Disease (Pseudoglioma) (NDP) antibody (ABIN4892212) Immunohistochemistry-Paraffin: NDP/Norrin Antibody [NBP1-59305] - Human Brain, cortex...
Western Blotting (WB) image for anti-Norrie Disease (Pseudoglioma) (NDP) antibody (ABIN4892212) Western Blot: NDP/Norrin Antibody [NBP1-59305] - Fetal Liver tissue lysate at a conce...