anti-Human NAV2 Antikörper für Immunohistochemistry

Recommended NAV2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Neuron Navigator 2 (NAV2) Antikörper
  • HELAD1
  • POMFIL2
  • RAINB1
  • STEERIN2
  • UNC53H2
  • 5330421F07Rik
  • AU067780
  • BQ960892
  • RAINB2
  • Unc53H2
  • mKIAA3015
  • Rainb1
  • neuron navigator 2
  • NAV2
  • nav2
  • Nav2
Reaktivität
Human
30
16
2
2
2
1
1
1
1
1
Wirt
Kaninchen
25
3
2
Klonalität
Polyklonal
Konjugat
Dieser NAV2 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
13
10
8
4
4
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4337962
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN3185852 ELISA IHC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4337961 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN571457 IHC WB Rabbit AA 2400-2450 Anmelden zum Anzeigen Polyclonal
1 ABIN571456 IHC WB Rabbit AA 960-1110 Anmelden zum Anzeigen Polyclonal

General

Antigen Neuron Navigator 2 (NAV2) Antikörper
Reaktivität Human
(30), (16), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(25), (3), (2)
Klonalität
Polyklonal
Konjugat Dieser NAV2 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(13), (10), (8), (4), (4), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-NAV2 Antikörper

Target Details NAV2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LREPSKTALGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLRRLFGGKPTKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPL
Isotyp IgG

Target Details NAV2

Produktdetails anti-NAV2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung NAV2 (NAV2 Antibody Abstract)
Hintergrund Gene Symbol: NAV2
Gen-ID 89797
Forschungsgebiet Neurogenesis, Organogenesis
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-NAV2 Antikörper Target Details NAV2 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-NAV2 Antikörper Target Details NAV2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-NAV2 Antikörper Target Details NAV2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Neuron Navigator 2 (NAV2) antibody (ABIN4337962) Immunohistochemistry: NAV2 Antibody [NBP1-84616] - Staining of human kidney shows str...