anti-Human MRPS12 Antikörper für Immunohistochemistry

Recommended MRPS12 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mitochondrial Ribosomal Protein S12 (MRPS12) Antikörper
  • CG7925
  • Dmel\\CG7925
  • EG:BACH59J11.1
  • MRP-S12
  • MRPS12
  • S12
  • Tko
  • l(1)3Ab
  • l(1)tko
  • mRpS12
  • mt-rps12
  • rps12
  • MGC64304
  • GB10531
  • MPR-S12
  • MT-RPS12
  • RPMS12
  • RPS12
  • RPSM12
  • AI327385
  • Rpms12
  • technical knockout
  • mitochondrial ribosomal protein S12
  • 40S ribosomal protein S12, mitochondrial
  • Mitochondrial protein; may interact with ribosomes based on co-purification experiments; similar to E. coli and human mitochondrial S12 ribosomal proteins
  • likely mitochondrial ribosomal protein similar to S. cerevisiae YNR036C and to Reclinomonas americana mitochondrial ribosomal protein S12
  • tko
  • mrps12
  • mRpS12
  • MRPS12
  • mrpS12
  • Mrps12
Reaktivität
Human
44
15
11
1
1
1
1
1
1
Wirt
Kaninchen
43
1
Klonalität
Polyklonal
Konjugat
Dieser MRPS12 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
41
25
18
5
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4335562
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4335563 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2584634 ELISA IHC WB Rabbit IgG AA 35-67 Anmelden zum Anzeigen Polyclonal
1 ABIN2327337 IHC ELISA WB Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN1914818 IHC ELISA WB Biotin Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN1914816 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN1914820 IHC ELISA WB PE Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN1914819 IHC ELISA WB FITC Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN1914821 IHC ELISA WB HRP Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN1914817 IHC ELISA WB APC Rabbit IgG AA 28-59 Anmelden zum Anzeigen Polyclonal
1 ABIN2327321 IHC ELISA WB FITC Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN2327325 IHC ELISA WB HRP Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN2327328 IHC ELISA WB PE Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN2327334 IHC ELISA WB APC Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN2327318 IHC ELISA WB Biotin Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN2327331 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 35-67, Center, Internal Region, Lys43 Anmelden zum Anzeigen Polyclonal
1 ABIN1088760 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1088759 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2146925 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Mitochondrial Ribosomal Protein S12 (MRPS12) Antikörper
Reaktivität Human
(44), (15), (11), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(43), (1)
Klonalität
Polyklonal
Konjugat Dieser MRPS12 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(41), (25), (18), (5), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MRPS12 Antikörper

Target Details MRPS12 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRL
Isotyp IgG

Target Details MRPS12

Produktdetails anti-MRPS12 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MRPS12 (MRPS12 Antibody Abstract)
Hintergrund Gene Symbol: MRPS12
Gen-ID 6183
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-MRPS12 Antikörper Target Details MRPS12 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MRPS12 Antikörper Target Details MRPS12 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-MRPS12 Antikörper Target Details MRPS12 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitochondrial Ribosomal Protein S12 (MRPS12) antibody (ABIN4335562) Immunohistochemistry-Paraffin: MRPS12 Antibody [NBP2-13620] Staining of human stomach...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Mitochondrial Ribosomal Protein S12 (MRPS12) antibody (ABIN4335562) Immunohistochemistry-Paraffin: MRPS12 Antibody - Staining of human duodenum shows cy...