anti-Human MKKS Antikörper für Immunofluorescence

Recommended MKKS Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
McKusick-Kaufman Syndrome (MKKS) Antikörper
  • bbs6
  • zgc:55608
  • MKKS
  • kms
  • mks
  • hmcs
  • DKFZp459L0833
  • BBS6
  • HMCS
  • KMS
  • MKS
  • 1300013E18Rik
  • AI463362
  • AI957237
  • Bbs6
  • McKusick-Kaufman syndrome
  • Mkks
  • mkks
  • MKKS
Reaktivität
Human
51
22
22
Wirt
Kaninchen
49
2
Klonalität
Polyklonal
Konjugat
Dieser MKKS Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
36
19
13
4
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4334825
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2408600 IF ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3059202 ICC IF WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen McKusick-Kaufman Syndrome (MKKS) Antikörper
Reaktivität Human
(51), (22), (22)
Wirt Kaninchen
(49), (2)
Klonalität
Polyklonal
Konjugat Dieser MKKS Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(36), (19), (13), (4), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MKKS Antikörper

Target Details MKKS Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTK
Isotyp IgG

Target Details MKKS

Produktdetails anti-MKKS Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MKKS (MKKS Antibody Abstract)
Hintergrund Gene Symbol: MKKS
Gen-ID 8195
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-MKKS Antikörper Target Details MKKS Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MKKS Antikörper Target Details MKKS Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-MKKS Antikörper Target Details MKKS Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-McKusick-Kaufman Syndrome (MKKS) antibody (ABIN4334825) Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-McKusick-Kaufman Syndrome (MKKS) antibody (ABIN4334825) Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon s...
Western Blotting (WB) image for anti-McKusick-Kaufman Syndrome (MKKS) antibody (ABIN4334825) Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-McKusick-Kaufman Syndrome (MKKS) antibody (ABIN4334825) Immunohistochemistry-Paraffin: MKKS Antibody - Staining of human colon shows strong ...