anti-Human Mucolipin 3 Antikörper für Immunohistochemistry

Recommended Mucolipin 3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mucolipin 3 (Mcoln3) Antikörper
  • MCOLN3
  • 6720490O21Rik
  • TRPML3
  • Va
  • TRP-ML3
  • trp-ml3
  • trpml3
  • mucolipin 3
  • MCOLN3
  • mcoln3
  • Mcoln3
Reaktivität
Human
38
14
13
4
4
3
3
3
2
2
2
2
1
1
Wirt
Kaninchen
41
3
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
42
18
17
2
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4336724
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4336725 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN350490 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 2
1 ABIN350496 IHC WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 2
1 ABIN350500 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 2
1 ABIN350497 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 2
1 ABIN350491 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 2
1 ABIN350493 IHC WB Sheep Anmelden zum Anzeigen Polyclonal 2
1 ABIN571448 IHC WB Goat Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2115247 ICC IHC WB Mouse IgG2a N-Term, AA 269-285 Anmelden zum Anzeigen N268-19

General

Antigen Mucolipin 3 (Mcoln3) Antikörper
Reaktivität Human
(38), (14), (13), (4), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(41), (3), (2), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(42), (18), (17), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Mucolipin 3 (Mcoln3 Antibody Abstract)
Hintergrund Gene Symbol: MCOLN3
Gen-ID 55283
UniProt Q8TDD5
Forschungsgebiet Neurology, Metabolism
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Mucolipin 3 (Mcoln3) antibody (ABIN4336724) Immunohistochemistry: Mucolipin 3 Antibody [NBP2-38951] - Staining of human adrenal g...