anti-Human Mucolipin 3 Antikörper für Immunocytochemistry

Recommended Mucolipin 3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Mucolipin 3 (Mcoln3) Antikörper
  • MCOLN3
  • 6720490O21Rik
  • TRPML3
  • Va
  • TRP-ML3
  • trp-ml3
  • trpml3
  • mucolipin 3
  • MCOLN3
  • mcoln3
  • Mcoln3
Reaktivität
Human
38
14
13
4
4
3
3
3
2
2
2
2
1
1
Wirt
Kaninchen
41
3
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
42
18
17
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4336725
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2115247 ICC IHC WB Mouse IgG2a N-Term, AA 269-285 Anmelden zum Anzeigen N268-19

General

Antigen Mucolipin 3 (Mcoln3) Antikörper
Reaktivität Human
(38), (14), (13), (4), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(41), (3), (2), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(42), (18), (17), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Mucolipin 3 (Mcoln3 Antibody Abstract)
Hintergrund Gene Symbol: MCOLN3
Gen-ID 55283
Forschungsgebiet Neurology, Metabolism
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Mucolipin 3 (Mcoln3) antibody (ABIN4336725) Immunocytochemistry/Immunofluorescence: Mucolipin 3 Antibody [NBP1-83791] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mucolipin 3 (Mcoln3) antibody (ABIN4336725) Immunohistochemistry-Paraffin: Mucolipin 3 Antibody [NBP1-83791] - Staining of human ...
Immunofluorescence (IF) image for anti-Mucolipin 3 (Mcoln3) antibody (ABIN4336725) Immunocytochemistry/Immunofluorescence: Mucolipin 3 Antibody - Immunofluorescent sta...