anti-Human Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) Antikörper
  • 1700008D07Rik
  • Lrtomt
  • RGD1565856
  • DFNB63
  • LRRC51
  • RGD1561509
  • Comt2
  • F930017I19Rik
  • leucine rich repeat containing 51
  • leucine rich transmembrane and O-methyltransferase domain containing
  • leucine-rich repeat-containing protein 51
  • O-methyltransferase domain containing
  • transmembrane O-methyltransferase
  • Lrrc51
  • LRTOMT
  • LRRC51
  • Tomt
Reaktivität
Human
8
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
8
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
7
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4331722
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5582775 IF IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) Antikörper
Reaktivität Human
(8), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(8)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(7), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LRTOMT (LRTOMT Antibody Abstract)
Hintergrund Gene Symbol: LRTOMT
Gen-ID 220074
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) antibody (ABIN4331722) Immunocytochemistry/Immunofluorescence: LRTOMT Antibody [NBP1-92081] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) antibody (ABIN4331722) Immunohistochemistry-Paraffin: LRTOMT Antibody [NBP1-92081] - Staining of human place...
Western Blotting (WB) image for anti-Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) antibody (ABIN4331722) Western Blot: LRTOMT Antibody [NBP1-92081] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) antibody (ABIN4331722) Immunohistochemistry-Paraffin: LRTOMT Antibody - Staining of human fallopian tube sh...