anti-Human Gap Junction Protein, gamma 3, 30.2kDa Antikörper für Immunocytochemistry

Recommended Gap Junction Protein, gamma 3, 30.2kDa Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Gap Junction Protein, gamma 3, 30.2kDa (GJc3) Antikörper
  • Cx29
  • Gje1
  • CX29
  • CX30.2
  • CX31.3
  • GJE1
  • gap junction protein, gamma 3, 30.2kDa
  • gap junction protein, gamma 3
  • LOC100349037
  • Gjc3
  • GJC3
Reaktivität
Human
46
20
17
3
Wirt
Kaninchen
52
13
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
37
36
13
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4314210
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Gap Junction Protein, gamma 3, 30.2kDa (GJc3) Antikörper
Reaktivität Human
(46), (20), (17), (3)
Wirt Kaninchen
(52), (13)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(37), (36), (13), (4), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GJC3 (GJc3 Antibody Abstract)
Hintergrund Gene Symbol: GJC3
Gen-ID 349149
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Gap Junction Protein, gamma 3, 30.2kDa (GJc3) antibody (ABIN4314210) Immunohistochemistry-Paraffin: GJC3 Antibody [NBP1-88040] - Staining of human cerebel...
Immunofluorescence (IF) image for anti-Gap Junction Protein, gamma 3, 30.2kDa (GJc3) antibody (ABIN4314210) Immunocytochemistry/Immunofluorescence: GJC3 Antibody [NBP1-88040] - Staining of huma...