anti-Human EYA1 Antikörper für Immunocytochemistry

Recommended EYA1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Eyes Absent Homolog 1 (Drosophila) (EYA1) Antikörper
  • EYA1
  • bop
  • bor
  • XEya1
  • wu:fc13c10
  • zgc:100770
  • BOP
  • BOR
  • BOS1
  • eyes absent homolog 1 (Drosophila)
  • eyes absent homolog 1
  • eyes absent 1 homolog (Drosophila)
  • EYA1
  • eya1
  • Eya1
Reaktivität
Human
47
37
29
9
8
8
7
7
6
4
2
1
1
1
Wirt
Kaninchen
49
15
1
Klonalität
Polyklonal
Konjugat
Dieser EYA1 Antikörper ist unkonjugiert
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
48
30
13
3
3
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076623
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN3060291 ICC IF IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen Eyes Absent Homolog 1 (Drosophila) (EYA1) Antikörper
Reaktivität Human
(47), (37), (29), (9), (8), (8), (7), (7), (6), (4), (2), (1), (1), (1)
Wirt Kaninchen
(49), (15), (1)
Klonalität
Polyklonal
Konjugat Dieser EYA1 Antikörper ist unkonjugiert
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(48), (30), (13), (3), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-EYA1 Antikörper

Target Details EYA1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
Isotyp IgG

Target Details EYA1

Produktdetails anti-EYA1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung EYA1 (EYA1 Antibody Abstract)
Hintergrund Gene Symbol: EYA1
Gen-ID 2138
Forschungsgebiet Organogenesis
Pathways Sensory Perception of Sound, Positive Regulation of Response to DNA Damage Stimulus

Anwendungsinformationen

Produktdetails anti-EYA1 Antikörper Target Details EYA1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-EYA1 Antikörper Target Details EYA1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-EYA1 Antikörper Target Details EYA1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Eyes Absent Homolog 1 (Drosophila) (EYA1) antibody (ABIN5076623) Immunocytochemistry/Immunofluorescence: EYA1 Antibody - Staining of human cell line ...