anti-Human DFNB31 Antikörper für Immunohistochemistry

Recommended DFNB31 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Deafness, Autosomal Recessive 31 (DFNB31) Antikörper
  • DFNB31
  • CIP98
  • PDZD7B
  • USH2D
  • WHRN
  • WI
  • Cip98
  • Whrn
  • 1110035G07Rik
  • AW122018
  • AW742671
  • C430046P22Rik
  • Dfnb31
  • wi
  • deafness, autosomal recessive 31
  • whirlin
  • DFNB31
  • dfnb31
  • Dfnb31
  • Whrn
Reaktivität
Human
32
6
Wirt
Kaninchen
30
6
Klonalität
Polyklonal
Konjugat
Dieser DFNB31 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
34
22
20
4
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4305095
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2598344 ELISA IHC WB Rabbit IgG AA 385-413 Anmelden zum Anzeigen Polyclonal
1 ABIN1973899 IHC ELISA WB HRP Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN1976022 IHC ELISA WB PE Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN1971422 IHC ELISA WB FITC Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN1962631 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN1969105 IHC ELISA WB Biotin Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN1965008 IHC ELISA WB APC Rabbit IgG AA 378-406 Anmelden zum Anzeigen Polyclonal
1 ABIN797977 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2252782 IHC ELISA WB Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252785 IHC ELISA WB PE Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252784 IHC ELISA WB HRP Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252783 IHC ELISA WB FITC Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252788 IHC ELISA WB APC Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252787 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2252789 IHC ELISA WB Biotin Rabbit IgG AA 385-413, Center, Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN347649 IHC ELISA WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN5576567 IHC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2797202 IHC WB Rabbit Ig Fraction Center Anmelden zum Anzeigen Polyclonal

General

Antigen Deafness, Autosomal Recessive 31 (DFNB31) Antikörper
Reaktivität Human
(32), (6)
Wirt Kaninchen
(30), (6)
Klonalität
Polyklonal
Konjugat Dieser DFNB31 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(34), (22), (20), (4), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-DFNB31 Antikörper

Target Details DFNB31 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASSRIRETMANSAGFLGDLTTEGINKPGFYKGPAGSQVTLSSLGNQTRVLLEEQARHLLNEQEH
Isotyp IgG

Target Details DFNB31

Produktdetails anti-DFNB31 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung DFNB31 (DFNB31 Antibody Abstract)
Hintergrund Gene Symbol: DFNB31
Gen-ID 25861
Forschungsgebiet Neurology
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-DFNB31 Antikörper Target Details DFNB31 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-DFNB31 Antikörper Target Details DFNB31 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-DFNB31 Antikörper Target Details DFNB31 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Deafness, Autosomal Recessive 31 (DFNB31) antibody (ABIN4305095) Immunohistochemistry: DFNB31 Antibody [NBP1-85612] - Staining of human duodenum shows...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Deafness, Autosomal Recessive 31 (DFNB31) antibody (ABIN4305095) Immunohistochemistry-Paraffin: DFNB31 Antibody - Staining of human adrenal gland sho...