anti-Human CEACAM16 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CEACAM16 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) Antikörper
  • CEAL2
  • DFNA4B
  • Gm769
  • Bcl3
  • carcinoembryonic antigen-related cell adhesion molecule 16
  • CEACAM16
  • Ceacam16
Reaktivität
Human
30
22
20
4
4
3
3
3
1
1
Wirt
Kaninchen
27
3
Klonalität
Polyklonal
Konjugat
Dieser CEACAM16 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
15
13
5
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4297600
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN889911 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN889914 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN872939 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5575203 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5541440 EIA FACS IHC (p) Mouse IgG2b Anmelden zum Anzeigen SU-9D5

General

Antigen Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) Antikörper
Reaktivität Human
(30), (22), (20), (4), (4), (3), (3), (3), (1), (1)
Wirt Kaninchen
(27), (3)
Klonalität
Polyklonal
Konjugat Dieser CEACAM16 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(15), (13), (5), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CEACAM16 Antikörper

Target Details CEACAM16 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT
Isotyp IgG

Target Details CEACAM16

Produktdetails anti-CEACAM16 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CEACAM16 (CEACAM16 Antibody Abstract)
Hintergrund Gene Symbol: CEACAM16
Gen-ID 388551
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-CEACAM16 Antikörper Target Details CEACAM16 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CEACAM16 Antikörper Target Details CEACAM16 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CEACAM16 Antikörper Target Details CEACAM16 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) antibody (ABIN4297600) Immunohistochemistry-Paraffin: CEACAM16 Antibody [NBP1-91777] - Staining of human kid...
Western Blotting (WB) image for anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) antibody (ABIN4297600) Western Blot: CEACAM16 Antibody [NBP1-91777] - Lane 1: Marker [kDa] 250, 130, 95, 72,...