anti-Human BarH-Like Homeobox 1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended BarH-Like Homeobox 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
BarH-Like Homeobox 1 (BARHL1) Antikörper
  • Dres115
  • MBH2
  • Barhl2
  • Mbh2
  • BarH-like 1 (Drosophila)
  • BarH-like homeobox 1
  • Barhl1
  • BARHL1
  • Barx1
Reaktivität
Human
32
2
2
1
1
1
1
1
1
Wirt
Kaninchen
23
9
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
29
22
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4283038
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4283037 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5649799 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen BarH-Like Homeobox 1 (BARHL1) Antikörper
Reaktivität Human
(32), (2), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(23), (9)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(29), (22), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung BARHL1 (BARHL1 Antibody Abstract)
Hintergrund Gene Symbol: BARHL1
Gen-ID 56751
Forschungsgebiet Transcription Factors, Chromatin and Nuclear Signaling
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-BarH-Like Homeobox 1 (BARHL1) antibody (ABIN4283038) Immunohistochemistry: BARHL1 Antibody [NBP1-86513] - Immunohistochemical staining of ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-BarH-Like Homeobox 1 (BARHL1) antibody (ABIN4283038) Immunohistochemistry-Paraffin: BARHL1 Antibody - Staining of human lateral ventricle...