anti-Human ROS1 Antikörper für Immunocytochemistry

Recommended ROS1 Antibody (geliefert von: Anmelden zum Anzeigen )

C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
  • MCF3
  • ROS
  • c-ros-1
  • ROS1C
  • Ros-1
  • c-ros
  • ROS proto-oncogene 1, receptor tyrosine kinase
  • ROS proto-oncogene 1 , receptor tyrosine kinase
  • Ros1 proto-oncogene
  • ROS1
  • Ros1
Dieser ROS1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5079381
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1931459 ELISA ICC IF IHC IHC (p) WB Alkaline Phosphatase (AP) Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931460 ELISA ICC IF IHC IHC (p) WB APC Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931462 ELISA ICC IF IHC IHC (p) WB FITC Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931461 ELISA ICC IF IHC IHC (p) WB Biotin Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931463 ELISA ICC IF IHC IHC (p) WB PE Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931464 ELISA ICC IF IHC IHC (p) WB HRP Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN4350974 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-1B
1 ABIN4350976 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-6G
1 ABIN4350973 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 5-4E
1 ABIN4350972 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 4-6G
1 ABIN4350975 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-2B
1 ABIN5013256 ICC IHC IP WB Rabbit IgG AA 1945-2222 Anmelden zum Anzeigen Polyclonal


Antigen C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
Reaktivität Human
(183), (7), (5), (3), (3), (3), (3), (2)
Wirt Kaninchen
(145), (31), (11)
Konjugat Dieser ROS1 Antikörper ist unkonjugiert
(9), (8), (8), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(156), (102), (36), (23), (17), (14), (13), (8), (6), (6), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ROS1 Antikörper

Target Details ROS1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVICLNSDDIMPVALMETKNREGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD
Isotyp IgG

Target Details ROS1

Produktdetails anti-ROS1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung ROS (ROS1 Antibody Abstract)
Hintergrund Gene Symbol: ROS1
Gen-ID 6098
Forschungsgebiet Transcription Factors, Cancer, Tyrosine Kinases
Pathways RTK Signalweg


Produktdetails anti-ROS1 Antikörper Target Details ROS1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) antibody (ABIN5079381) Immunocytochemistry/Immunofluorescence: ROS Antibody - Staining of human cell line U...