anti-Human RASGRF1 Antikörper für Immunofluorescence

Recommended RASGRF1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1) Antikörper
  • rasgrf1
  • CDC25
  • PPP1R60
  • CDC25L
  • GNRP
  • GRF1
  • GRF55
  • H-GRF55
  • PP13187
  • ras-GRF1
  • AI844718
  • CDC25Mm
  • Grf1
  • Grfbeta
  • P190-A
  • Ras-GRF1
  • p190
  • p190RhoGEF
  • cdc25
  • Ras protein-specific guanine nucleotide-releasing factor 1
  • si:ch211-234p18.3
  • cell division cycle 25C
  • RAS protein-specific guanine nucleotide-releasing factor 1
  • RASGRF1
  • si:ch211-234p18.3
  • rasgrf1
  • CDC25C
  • Rasgrf1
Reaktivität
Human
73
62
55
4
4
4
3
3
3
3
2
1
1
Wirt
Kaninchen
91
Klonalität
Polyklonal
Konjugat
Dieser RASGRF1 Antikörper ist unkonjugiert
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
44
33
29
26
21
3
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4349416
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.322945 ABIN2564889 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2882908 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

Ähnliche anti-RASGRF1 Antikörper

Applikation / Reaktivität Human
ELISA 20 Antikörper
Enzyme Immunoassay (EIA) 2 Antikörper
Immunocytochemistry (ICC) 1 Antikörper
Immunofluorescence (IF) 3 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 26 Antikörper
Immunohistochemistry (IHC) 23 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 17 Antikörper
Immunoprecipitation (IP) 1 Antikörper
Western Blotting (WB) 41 Antikörper

General

Antigen Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1 (RASGRF1) Antikörper
Reaktivität Human
(73), (62), (55), (4), (4), (4), (3), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(91)
Klonalität
Polyklonal
Konjugat Dieser RASGRF1 Antikörper ist unkonjugiert
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(44), (33), (29), (26), (21), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RASGRF1 Antikörper

Target Details RASGRF1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTE
Isotyp IgG

Target Details RASGRF1

Produktdetails anti-RASGRF1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung RASGRF1 (RASGRF1 Antibody Abstract)
Hintergrund Gene Symbol: RASGRF1
Gen-ID 5923
Forschungsgebiet Signaling
Pathways RTK Signalweg, Zellzyklus, M Phase

Anwendungsinformationen

Produktdetails anti-RASGRF1 Antikörper Target Details RASGRF1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RASGRF1 Antikörper Target Details RASGRF1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-RASGRF1 Antikörper Target Details RASGRF1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-RASGRF1 Antikörper (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1) (ABIN4349416) Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Staining of h...
Immunohistochemistry (IHC) image for anti-RASGRF1 Antikörper (Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1) (ABIN4349416) Immunohistochemistry: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows s...