anti-Human RAC3 Antikörper für Immunohistochemistry

Recommended RAC3 Antibody (geliefert von: Anmelden zum Anzeigen )

Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) Antikörper
  • Rac1B
  • rac3
  • zgc:100831
  • RAS-related C3 botulinum substrate 3
  • ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  • ras-related C3 botulinum toxin substrate 3a (rho family, small GTP binding protein Rac3)
  • Rac3
  • RAC3
  • rac3a
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4349055
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4904939 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2883253 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1091378 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1091379 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2975002 IF/ICC IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2150220 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2923058 ELISA IF/ICC IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3048815 IF/ICC IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

Ähnliche anti-RAC3 Antikörper

Applikation / Reaktivität Human
ELISA 4 Antikörper
Immunofluorescence (IF) 4 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 3 Antikörper
Immunohistochemistry (IHC) 9 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antikörper
Western Blotting (WB) 12 Antikörper


Antigen Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) Antikörper
Reaktivität Human
(11), (7), (7)
Wirt Kaninchen
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(11), (8), (4), (4), (3)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RAC3 Antikörper

Target Details RAC3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
Isotyp IgG

Target Details RAC3

Produktdetails anti-RAC3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung RAC3 (RAC3 Antibody Abstract)
Hintergrund Gene Symbol: RAC3
Gen-ID 5881
UniProt P60763
Pathways RTK Signalweg


Produktdetails anti-RAC3 Antikörper Target Details RAC3 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-RAC3 Antikörper Target Details RAC3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-RAC3 Antikörper Target Details RAC3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-RAC3 Antikörper (Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3)) (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - liver cancer
Western Blotting (WB) image for anti-RAC3 Antikörper (Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3)) (ABIN4349055) Western Blot: RAC3 Antibody [NBP2-32058] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (IHC) image for anti-RAC3 Antikörper (Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3)) (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - Immunohistochemical staining of hu...
Immunohistochemistry (IHC) image for anti-RAC3 Antikörper (Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3)) (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - skin