anti-Human GDNF Antikörper für Immunofluorescence

Recommended GDNF Antibody (geliefert von: Anmelden zum Anzeigen )

Glial Cell Line Derived Neurotrophic Factor (GDNF) Antikörper
  • gdnf
  • GDNF
  • AI385739
  • gdnfa
  • hfb1-gdnf
  • ATF1
  • ATF2
  • HSCR3
  • glial cell derived neurotrophic factor
  • glial cell derived neurotrophic factor a
  • glial cell line derived neurotrophic factor
  • glial cell derived neurotrophic factor L homeolog
  • Gdnf
  • gdnfa
  • GDNF
  • gdnf.L
Dieser GDNF Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5076925
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5066753 ICC IF WB Atto 594 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066764 ICC IF WB PerCP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066755 ICC IF WB Atto 655 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066763 ICC IF WB PE-Atto 594 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066766 ICC IF WB Streptavidin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066752 ICC IF WB Atto 565 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066750 ICC IF WB Atto 390 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066756 ICC IF WB Atto 680 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066754 ICC IF WB Atto 633 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066757 ICC IF WB Atto 700 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066759 ICC IF WB APC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066758 ICC IF WB Alkaline Phosphatase (AP) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066760 ICC IF WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066761 ICC IF WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066762 ICC IF WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066765 ICC IF WB PE Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5066751 ICC IF WB Atto 488 Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5540934 EIA ICC IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 3C1
1 ABIN5066749 ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1172050 ICC IF IHC WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen Glial Cell Line Derived Neurotrophic Factor (GDNF) Antikörper
Reaktivität Human
(139), (58), (53), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(124), (20), (9), (3)
Konjugat Dieser GDNF Antikörper ist unkonjugiert
(14), (9), (6), (4), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(141), (54), (29), (27), (20), (13), (11), (11), (6), (4), (4), (3), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GDNF Antikörper

Target Details GDNF Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRG
Isotyp IgG

Target Details GDNF

Produktdetails anti-GDNF Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung GDNF (GDNF Antibody Abstract)
Hintergrund Gene Symbol: GDNF
Gen-ID 2668
Forschungsgebiet Growth Factors, Organogenesis
Pathways RTK Signalweg, Synaptic Membrane, Tube Formation, Autophagie, Smooth Muscle Cell Migration


Produktdetails anti-GDNF Antikörper Target Details GDNF Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-GDNF Antikörper Target Details GDNF Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-GDNF Antikörper Target Details GDNF Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Glial Cell Line Derived Neurotrophic Factor (GDNF) antibody (ABIN5076925) Immunocytochemistry/Immunofluorescence: GDNF Antibody - Staining of human cell line ...