anti-Human FGF3 Antikörper für Immunofluorescence

Recommended FGF3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Fibroblast Growth Factor 3 (FGF3) Antikörper
  • HBGF-3
  • INT2
  • Int2
  • Fgf-3
  • Int-2
  • Int-P
  • INT-2
  • XFGF-3
  • fgf3-A
  • xfgf3
  • FGF-3
  • id:ibd5006
  • fibroblast growth factor 3
  • FGF3
  • Fgf3
  • fgf3
Reaktivität
Human
68
40
24
21
3
3
3
2
2
2
2
2
2
1
Wirt
Kaninchen
39
31
Klonalität
Polyklonal
Konjugat
Dieser FGF3 Antikörper ist unkonjugiert
5
4
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
53
36
25
16
13
11
4
4
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4311605
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN329823 ICC IF IHC WB Mouse IgG2a Anmelden zum Anzeigen
1 ABIN268314 IF IHC IHC (fro) IHC (p) IP WB Mouse IgG2a Anmelden zum Anzeigen MSD1
1 ABIN5578095 IF IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5578094 ICC IF IHC WB Mouse IgG2a Anmelden zum Anzeigen MSD1

Ähnliche anti-FGF3 Antikörper

Applikation / Reaktivität Human
Blocking Peptide (BP) 1 Antikörper
ELISA 11 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 5 Antikörper
Immunofluorescence (IF) 5 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 26 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 37 Antikörper
Immunoprecipitation (IP) 3 Antikörper
Neutralization (Neut) 2 Antikörper
Western Blotting (WB) 51 Antikörper

General

Antigen Fibroblast Growth Factor 3 (FGF3) Antikörper
Reaktivität Human
(68), (40), (24), (21), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1)
Wirt Kaninchen
(39), (31)
Klonalität
Polyklonal
Konjugat Dieser FGF3 Antikörper ist unkonjugiert
(5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(53), (36), (25), (16), (13), (11), (4), (4), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FGF3 Antikörper

Target Details FGF3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Isotyp IgG

Target Details FGF3

Produktdetails anti-FGF3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FGF-3 (FGF3 Antibody Abstract)
Hintergrund Gene Symbol: FGF3
Gen-ID 2248
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung

Anwendungsinformationen

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-FGF3 Antikörper Target Details FGF3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FGF3 Antikörper (Fibroblast Growth Factor 3) (ABIN4311605) Immunohistochemistry-Paraffin: FGF-3 Antibody [NBP1-89718] - Staining of human placen...
Immunofluorescence (IF) image for anti-FGF3 Antikörper (Fibroblast Growth Factor 3) (ABIN4311605) Immunocytochemistry/Immunofluorescence: FGF-3 Antibody [NBP1-89718] - Staining of hum...