anti-Human FGF1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended FGF1 Antibody (geliefert von: Anmelden zum Anzeigen )

Fibroblast Growth Factor 1 (Acidic) (FGF1) Antikörper
  • FGF1
  • zgc:136885
  • aFGF
  • ecgf
  • fgfa
  • ecgfa
  • ecgfb
  • fgf-1
  • hbgf1
  • HBGF-1
  • glio703
  • ecgf-beta
  • fgf-alpha
  • LOC100221393
  • FGF-1
  • Fgf1
  • Dffrx
  • Fam
  • Fgf-1
  • Fgfa
  • ECGF
  • AFGF
  • ECGF-beta
  • FGF-alpha
  • FGFA
  • GLIO703
  • HBGF1
  • fibroblast growth factor 1 (acidic)
  • fibroblast growth factor 1b
  • acidic fibroblast growth factor
  • fibroblast growth factor 1
  • fgf1
  • FGF1
  • fgf1b
  • LOC100221393
  • AFGF
  • Fgf1
Dieser FGF1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4311439
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN390361 IF IHC (p) WB Rabbit Ig AA 5-30, N-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN4886581 ELISA IHC (p) WB Rabbit IgG AA 16-155 Anmelden zum Anzeigen Polyclonal
1 ABIN5610974 EIA IHC (p) WB Rabbit Ig Fraction N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN3044308 ELISA IHC (p) WB Rabbit IgG AA 16-155 Anmelden zum Anzeigen Polyclonal
1 ABIN626048 IF IHC (p) ELISA WB Mouse IgG1, kappa AA 46-155 Anmelden zum Anzeigen 1F9
1 ABIN626047 IF IHC (p) IP ELISA WB Mouse IgG1, kappa AA 46-155 Anmelden zum Anzeigen 2E12
1 ABIN726590 IF (p) IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1498254 IHC (p) Neut ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2450557 IP IHC (p) Neut ELISA WB Rabbit IgG AA 16-155 Anmelden zum Anzeigen Polyclonal
1 ABIN781862 EIA IF IHC (p) IP WB Mouse IgG1 Anmelden zum Anzeigen 2-00E-012
1 ABIN781861 EIA IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 1F9
1 ABIN726599 IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2892580 IHC (p) Rabbit His56 Anmelden zum Anzeigen Polyclonal
1 ABIN116006 EIA Func IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN726592 IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2601884 ELISA IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN116005 EIA Func IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN1841218 IF IHC (p) WB Rabbit AA 5-30 Anmelden zum Anzeigen Polyclonal
1 ABIN1723660 IF IHC (p) IP ELISA WB Mouse IgG1 kappa AA 46-155 Anmelden zum Anzeigen (2E12)
1 ABIN1723661 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 46-155 Anmelden zum Anzeigen 1F9


Antigen Fibroblast Growth Factor 1 (Acidic) (FGF1) Antikörper
Reaktivität Human
(158), (81), (55), (16), (9), (6), (6), (5), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(172), (52)
Konjugat Dieser FGF1 Antikörper ist unkonjugiert
(19), (14), (9), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(145), (123), (50), (30), (28), (24), (13), (12), (10), (9), (6), (5), (4), (2), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FGF1 Antikörper

Target Details FGF1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Isotyp IgG

Target Details FGF1

Produktdetails anti-FGF1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung FGF Acidic/FGF1 (FGF1 Antibody Abstract)
Hintergrund Gene Symbol: FGF1
Gen-ID 2246
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung


Produktdetails anti-FGF1 Antikörper Target Details FGF1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-FGF1 Antikörper Target Details FGF1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-FGF1 Antikörper Target Details FGF1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunocytochemistry/Immunofluorescence: FGF1 Antibody [NBP1-89213] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunohistochemistry-Paraffin: FGF1 Antibody [NBP1-89213] - Staining of human kidney ...