anti-Human EPH Receptor B6 Antikörper für Immunocytochemistry

Recommended EPH Receptor B6 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
EPH Receptor B6 (EPHB6) Antikörper
  • CEK9
  • EPHB5
  • Cekl
  • Mep
  • HEP
  • EPH receptor B6
  • Eph receptor B6
  • EPHB6
  • LOC100218302
  • Ephb6
Reaktivität
Human
181
65
36
4
3
1
1
1
1
Wirt
Kaninchen
105
69
16
6
4
Klonalität
Polyklonal
Konjugat
Dieser EPH Receptor B6 Antikörper ist unkonjugiert
11
9
8
7
6
6
6
6
5
5
4
4
4
2
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
142
101
76
58
45
16
13
9
5
4
3
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076559
Preis und Verfügbarkeit auf Anfrage.

General

Antigen EPH Receptor B6 (EPHB6) Antikörper
Reaktivität Human
(181), (65), (36), (4), (3), (1), (1), (1), (1)
Wirt Kaninchen
(105), (69), (16), (6), (4)
Klonalität
Polyklonal
Konjugat Dieser EPH Receptor B6 Antikörper ist unkonjugiert
(11), (9), (8), (7), (6), (6), (6), (6), (5), (5), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(142), (101), (76), (58), (45), (16), (13), (9), (5), (4), (3), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-EPH Receptor B6 Antikörper

Target Details EPH Receptor B6 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY
Isotyp IgG

Target Details EPH Receptor B6

Produktdetails anti-EPH Receptor B6 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung EphB6 (EPHB6 Antibody Abstract)
Hintergrund Gene Symbol: EPHB6
Gen-ID 2051
Pathways RTK Signalweg, Hormone Transport

Anwendungsinformationen

Produktdetails anti-EPH Receptor B6 Antikörper Target Details EPH Receptor B6 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-EPH Receptor B6 Antikörper Target Details EPH Receptor B6 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-EPH Receptor B6 Antikörper Target Details EPH Receptor B6 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-EPH Receptor B6 (EPHB6) antibody (ABIN5076559) Immunocytochemistry/Immunofluorescence: EphB6 Antibody - Staining of human cell line...