anti-Human EPH Receptor A10 Antikörper für Immunocytochemistry

Recommended EPH Receptor A10 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
EPH Receptor A10 (EPHA10) Antikörper
  • A330090H18
  • RGD1562679
  • EPH receptor A10
  • Eph receptor A10
  • EPHA10
  • Epha10
Reaktivität
Human
69
29
25
Wirt
Kaninchen
57
12
Klonalität
Polyklonal
Konjugat
Dieser EPH Receptor A10 Antikörper ist unkonjugiert
3
3
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
47
38
20
13
8
4
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4308645
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1867763 ICC IHC IP WB Rabbit IgG AA 645-900 Anmelden zum Anzeigen Polyclonal

Ähnliche anti-EPH Receptor A10 Antikörper

Applikation / Reaktivität Human
ELISA 38 Antikörper
Enzyme Immunoassay (EIA) 4 Antikörper
Flow Cytometry (FACS) 1 Antikörper
Immunocytochemistry (ICC) 2 Antikörper
Immunofluorescence (IF) 1 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 21 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antikörper
Immunoprecipitation (IP) 1 Antikörper
Western Blotting (WB) 47 Antikörper

General

Antigen EPH Receptor A10 (EPHA10) Antikörper
Reaktivität Human
(69), (29), (25)
Wirt Kaninchen
(57), (12)
Klonalität
Polyklonal
Konjugat Dieser EPH Receptor A10 Antikörper ist unkonjugiert
(3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(47), (38), (20), (13), (8), (4), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-EPH Receptor A10 Antikörper

Target Details EPH Receptor A10 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS
Isotyp IgG

Target Details EPH Receptor A10

Produktdetails anti-EPH Receptor A10 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung EphA10 (EPHA10 Antibody Abstract)
Hintergrund Gene Symbol: EPHA10
Gen-ID 284656
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-EPH Receptor A10 Antikörper Target Details EPH Receptor A10 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-EPH Receptor A10 Antikörper Target Details EPH Receptor A10 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-EPH Receptor A10 Antikörper Target Details EPH Receptor A10 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-EPH Receptor A10 Antikörper (EPHA10) (ABIN4308645) Immunohistochemistry-Paraffin: EPHA10 Antibody [NBP1-83677] - Staining of human vulva...
Immunofluorescence (IF) image for anti-EPH Receptor A10 Antikörper (EPHA10) (ABIN4308645) Immunocytochemistry/Immunofluorescence: EPHA10 Antibody [NBP1-83677] - Staining of hu...