anti-Human AATK Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended AATK Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Apoptosis-Associated tyrosine Kinase (AATK) Antikörper
  • AATYK
  • AATYK1
  • LMR1
  • LMTK1
  • p35BP
  • aatyk1
  • mKIAA0641
  • apoptosis-associated tyrosine kinase
  • AATK
  • Aatk
Reaktivität
Human
50
11
4
Wirt
Kaninchen
36
19
Klonalität
Polyklonal
Konjugat
Dieser AATK Antikörper ist unkonjugiert
3
3
3
3
3
3
3
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
25
24
23
11
4
2
2
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4277117
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN599090 IHC (p) ELISA WB Mouse IgG1, kappa AA 161-260 Anmelden zum Anzeigen 5H5
1 ABIN1805449 IHC (p) ELISA WB Mouse IgG1, kappa AA 161-260 Anmelden zum Anzeigen 5B8
1 ABIN564158 IHC (p) ELISA WB Mouse IgG1 kappa AA 161-260, partial Anmelden zum Anzeigen 5H5
1 ABIN2752047 IHC (p) ELISA WB Mouse IgG1 kappa AA 161-260, partial Anmelden zum Anzeigen 5B8

General

Antigen Apoptosis-Associated tyrosine Kinase (AATK) Antikörper
Reaktivität Human
(50), (11), (4)
Wirt Kaninchen
(36), (19)
Klonalität
Polyklonal
Konjugat Dieser AATK Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3), (3), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(25), (24), (23), (11), (4), (2), (2), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-AATK Antikörper

Target Details AATK Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSA
Isotyp IgG

Target Details AATK

Produktdetails anti-AATK Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung AATK/Serine/threonine-Protein Kinase LMTK1 (AATK Antibody Abstract)
Hintergrund Gene Symbol: AATK
Gen-ID 9625
Pathways RTK Signalweg, Regulation of Cell Size

Anwendungsinformationen

Produktdetails anti-AATK Antikörper Target Details AATK Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-AATK Antikörper Target Details AATK Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-AATK Antikörper Target Details AATK Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Apoptosis-Associated Tyrosine Kinase (AATK) antibody (ABIN4277117) Immunocytochemistry/Immunofluorescence: AATK/Serine/threonine-protein kinase LMTK1 An...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Apoptosis-Associated Tyrosine Kinase (AATK) antibody (ABIN4277117) Immunohistochemistry-Paraffin: AATK/Serine/threonine-protein kinase LMTK1 Antibody [N...
 image for anti-Apoptosis-Associated Tyrosine Kinase (AATK) antibody (ABIN4277117) AATK/Serine/threonine-protein kinase LMTK1 Antibody - Staining of human cerebral cor...