anti-Human MOCOS Antikörper für Immunocytochemistry

Recommended MOCOS Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Molybdenum Cofactor Sulfurase (MOCOS) Antikörper
  • MCS
  • mocos
  • MGC110784
  • MGC158545
  • im:7142948
  • ABA DEFICIENT 3
  • ACI2
  • ALTERED CHLOROPLAST IMPORT 2
  • ATABA3
  • F19K19.13
  • F19K19_13
  • LOS5
  • LOW OSMOTIC STRESS 5
  • MOLYBDENUM COFACTOR SULFURASE
  • SIR3
  • SIRTINOL RESISTANT 3
  • DDBDRAFT_0217046
  • DDBDRAFT_0252757
  • DDB_0217046
  • DDB_0252757
  • Og
  • HMCS
  • MOS
  • 1110018O12Rik
  • molybdenum cofactor sulfurase
  • zgc:110784
  • MOCOS
  • zgc:110784
  • ABA3
  • AOR_1_1090144
  • mocos
  • MCYG_05594
  • VDBG_04857
  • MGYG_02684
  • TERG_06775
  • mal
  • Mocos
Reaktivität
Human, Maus
9
4
3
Wirt
Kaninchen
8
1
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
8
5
4
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4335161
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4335160 ICC IF IHC IHC (p) SimWes WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Molybdenum Cofactor Sulfurase (MOCOS) Antikörper
Reaktivität Human, Maus
(9), (4), (3)
Wirt Kaninchen
(8), (1)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(8), (5), (4), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MOCOS Antikörper

Target Details MOCOS Anwendungsinformationen Handhabung Referenzen für anti-MOCOS Antikörper (ABIN4335161) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIK QSSNSQRNAKKK
Isotyp IgG

Target Details MOCOS

Produktdetails anti-MOCOS Antikörper Anwendungsinformationen Handhabung Referenzen für anti-MOCOS Antikörper (ABIN4335161) Bilder zurück nach oben
Antigen
Andere Bezeichnung MOCOS (MOCOS Antibody Abstract)
Hintergrund Gene Symbol: MOCOS
Gen-ID 55034
Pathways Response to Water Deprivation, ER-Nucleus Signaling

Anwendungsinformationen

Produktdetails anti-MOCOS Antikörper Target Details MOCOS Handhabung Referenzen für anti-MOCOS Antikörper (ABIN4335161) Bilder zurück nach oben
Applikationshinweise Western Blot 1:250 - 1:500, Simple Western 1:30, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26239292). In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MOCOS Antikörper Target Details MOCOS Anwendungsinformationen Referenzen für anti-MOCOS Antikörper (ABIN4335161) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-MOCOS Antikörper (ABIN4335161)

Produktdetails anti-MOCOS Antikörper Target Details MOCOS Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Féron, Gepner, Lacassagne, Stephan, Mesnage, Blanchard, Boulanger, Tardif, Devèze, Rousseau, Suzuki, Izpisua Belmonte, Khrestchatisky, Nivet, Erard-Garcia: "Olfactory stem cells reveal MOCOS as a new player in autism spectrum disorders." in: Molecular psychiatry, Vol. 21, Issue 9, pp. 1215-24, 2016 Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence,Immunohistochemistry

Bilder

Produktdetails anti-MOCOS Antikörper Target Details MOCOS Anwendungsinformationen Handhabung Referenzen für anti-MOCOS Antikörper (ABIN4335161) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomac...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specif...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of correspond...
Immunofluorescence (IF) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunocytochemistry/Immunofluorescence: MOCOS Antibody - Immunofluorescent staining ...