anti-Human LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) Antikörper
  • K24G6.21
  • K24G6_21
  • SUPERSENSITIVE TO ABA AND DROUGHT 1
  • An13g00820
  • YER146W
  • 2010208O10Rik
  • 2310034K10Rik
  • LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • LSM5 homolog, U6 small nuclear RNA associated
  • U6 snRNA-associated Sm-like protein LSm5
  • Lsm5
  • LSM5
  • lsm5
  • SAD1
  • ANI_1_116114
  • PVX_118325
  • SS1G_05691
  • Bm1_50275
  • Bm1_50295
  • AOR_1_212174
Reaktivität
Human
27
8
8
4
4
3
3
3
3
2
2
2
2
1
1
1
Wirt
Kaninchen
11
9
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
21
16
4
4
4
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4331773
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5582784 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) Antikörper
Reaktivität Human
(27), (8), (8), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(11), (9), (7)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(21), (16), (4), (4), (4), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LSM5 (LSM5 Antibody Abstract)
Hintergrund Gene Symbol: LSM5
Gen-ID 23658
Pathways Response to Water Deprivation

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) antibody (ABIN4331773) Western Blot: LSM5 Antibody [NBP1-92082] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) antibody (ABIN4331773) Immunohistochemistry-Paraffin: LSM5 Antibody [NBP1-92082] - Staining of human duodenu...