anti-Human S100 Calcium Binding Protein P Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended S100 Calcium Binding Protein P Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
S100 Calcium Binding Protein P (S100P) Antikörper
  • S100P
  • MIG9
  • S100 calcium binding protein P
  • S100 calcium binding protein B
  • S100P
  • s100p
  • S100b
  • S100p
Reaktivität
Human
67
2
2
1
Wirt
Kaninchen
45
20
1
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
3
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
45
31
13
13
12
6
6
4
1
1
1
1
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4351825
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1999809 IHC (p) Rabbit IgG AA 1-95 Anmelden zum Anzeigen 116
1 ABIN1999811 IHC (p) ELISA Rabbit IgG AA 1-95 Anmelden zum Anzeigen Polyclonal
1 ABIN754792 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3201678 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 1-95 Anmelden zum Anzeigen
1 ABIN754785 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN754783 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen S100 Calcium Binding Protein P (S100P) Antikörper
Reaktivität Human
(67), (2), (2), (1)
Wirt Kaninchen
(45), (20), (1), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(5), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(45), (31), (13), (13), (12), (6), (6), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung S100P (S100P Antibody Abstract)
Hintergrund Gene Symbol: S100P
Gen-ID 6286
Forschungsgebiet Cancer
Pathways Regulation of Muscle Cell Differentiation, Toll-Like Receptors Cascades

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:1000 - 1:2500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:2500 - 1:5000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-S100 Calcium Binding Protein P (S100P) antibody (ABIN4351825) Western Blot: S100P Antibody [NBP1-89541] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunofluorescence (IF) image for anti-S100 Calcium Binding Protein P (S100P) antibody (ABIN4351825) Immunocytochemistry/Immunofluorescence: S100P Antibody [NBP1-89541] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-S100 Calcium Binding Protein P (S100P) antibody (ABIN4351825) Immunohistochemistry-Paraffin: S100P Antibody [NBP1-89541] - Immunohistochemical stai...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-S100 Calcium Binding Protein P (S100P) antibody (ABIN4351825) Immunohistochemistry-Paraffin: S100P Antibody - Staining of human placenta shows str...