anti-Human TAP2 Antikörper für Western Blotting

Recommended TAP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2) Antikörper
  • ABC18
  • ABCB3
  • APT2
  • D6S217E
  • PSF-2
  • PSF2
  • RING11
  • AI462429
  • Abcb3
  • Ham-2
  • Ham2
  • MTP2
  • Tap-2
  • Y1
  • jas
  • Cim
  • transporter 2, ATP binding cassette subfamily B member
  • transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
  • TAP2
  • Tap2
Epitop
AA 611-651, C-Term
19
6
3
2
2
2
1
1
1
1
1
Reaktivität
Human
88
43
42
Wirt
Kaninchen
84
3
2
Klonalität
Polyklonal
Konjugat
Dieser TAP2 Antikörper ist unkonjugiert
5
5
5
3
2
2
2
2
2
2
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
39
36
26
26
18
15
7
5
4
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043415
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.226648 ABIN2853577 FACS IHC (p) IP WB Mouse IgG1 AA 434-703 Anmelden zum Anzeigen TAP1-28
3.226648 ABIN3042650 WB Rabbit IgG AA 667-686, C-Term Anmelden zum Anzeigen Polyclonal
3.226648 ABIN4891864 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
3.226648 ABIN4891865 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
3.226648 ABIN1875021 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.226648 ABIN3022237 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.226648 ABIN2967081 IC IF WB Rabbit Anmelden zum Anzeigen Polyclonal
3.226648 ABIN2468064 WB Chicken AA 1-185 Anmelden zum Anzeigen Polyclonal
3.226648 ABIN4348150 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.226648 ABIN262013 WB Chicken Anmelden zum Anzeigen Polyclonal
3.226648 ABIN3029263 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
3.226648 ABIN2404398 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.226648 ABIN520697 WB Rabbit AA 1-686, full length Anmelden zum Anzeigen Polyclonal
3.226648 ABIN2433981 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.226648 ABIN5013138 ICC IHC IP WB Rabbit IgG AA 468-686 Anmelden zum Anzeigen Polyclonal
1 ABIN680123 FACS IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN680132 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2628960 WB Rabbit IgG AA 667-686 Anmelden zum Anzeigen Polyclonal
1 ABIN680125 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2879811 IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2) Antikörper
Epitop AA 611-651, C-Term
(19), (6), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reaktivität Human
(88), (43), (42)
Wirt Kaninchen
(84), (3), (2)
Klonalität
Polyklonal
Konjugat Dieser TAP2 Antikörper ist unkonjugiert
(5), (5), (5), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Western Blotting (WB)
(39), (36), (26), (26), (18), (15), (7), (5), (4), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TAP2 Antikörper

Target Details TAP2 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
Sequenz QKQRLAIARA LVRDPRVLIL DEATSALDVQ CEQALQDWNS R
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
Gene Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 2
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Isotyp IgG

Target Details TAP2

Produktdetails anti-TAP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TAP2 (TAP2 Antibody Abstract)
Hintergrund Transporter, ATP-binding cassette, major histocompatibility complex 2(TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum.

Synonyms: ABC transporter, MHC 2 antibody|ABC18 antibody|ABCB3 antibody|Antigen peptide transporter 2 antibody|APT2 antibody|ATP binding cassette, sub family B (MDR/TAP), member 3 antibody|D6S217E antibody|Peptide supply factor 2 antibody|Peptide transporter involved in antigen processing 2 antibody|Peptide transporter PSF2 antibody|Peptide transporter TAP2 antibody|PSF 2 antibody|PSF2 antibody|Really interesting new gene 11 protein antibody|RING 11 antibody|RING11 antibody|TAP 2 antibody|Transporter 2 ATP binding cassette sub family B antibody|Transporter 2, ABC (ATP binding cassette antibody|Transporter 2, ATP binding cassette, sub family B (MDR/TAP) antibody
Gen-ID 6891
UniProt Q03519
Forschungsgebiet Signaling, Organelles
Pathways Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process

Anwendungsinformationen

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2) (AA 611-651), (C-Term) antibody (ABIN3043415) Observed bind size: 87KD