anti-Human STXBP2 Antikörper für Western Blotting

Recommended STXBP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Syntaxin Binding Protein 2 (STXBP2) Antikörper
  • zgc:85807
  • FHL5
  • Hunc18b
  • MUNC18-2
  • UNC18-2
  • UNC18B
  • pp10122
  • C79054
  • Munc-18-2
  • Munc-18b
  • Munc18b
  • Sxtbp2
  • Sxtp2
  • Unc18-2
  • Unc18b
  • muSec1
  • MUNC-18-2
  • syntaxin binding protein 2
  • stxbp2
  • STXBP2
  • Stxbp2
AA 184-215, N-Term
Human, Maus, Ratte (Rattus)
Dieser STXBP2 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN3043304
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.0855882 ABIN954993 EIA WB Rabbit Ig C-Term, AA 439-469 Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN443207 ICC IF WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN2855556 ICC IF WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN1537338 WB Rabbit Ig AA 440-469, C-Term Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN2737618 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN2967132 IC IF IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
3.0855882 ABIN2428907 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN337084 IHC (p) IP WB Rabbit AA 58-70 Anmelden zum Anzeigen Polyclonal
1 ABIN201270 IP WB Rabbit IgG AA 58-70 Anmelden zum Anzeigen Polyclonal
1 ABIN596426 ELISA WB Goat IgG AA 81-223 Anmelden zum Anzeigen Polyclonal
1 ABIN1832991 ICC WB Rabbit IgG AA 101-371 Anmelden zum Anzeigen Polyclonal
1 ABIN1885942 IF WB Rabbit AA 101-341 Anmelden zum Anzeigen Polyclonal
1 ABIN1939292 ELISA WB APC Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN1939291 ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN1939295 ELISA WB PE Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN1939296 ELISA WB HRP Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN1939293 ELISA WB Biotin Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN1939294 ELISA WB FITC Rabbit IgG AA 440-469 Anmelden zum Anzeigen Polyclonal
1 ABIN5533441 WB Rabbit Ig Fraction AA 440-469, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2573043 ELISA WB Rabbit IgG AA 439-469 Anmelden zum Anzeigen Polyclonal


Antigen Syntaxin Binding Protein 2 (STXBP2) Antikörper
Epitop AA 184-215, N-Term
(11), (10), (9), (2), (2), (2), (2), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(40), (9), (9), (2), (2), (2), (2), (2), (2), (2)
Wirt Kaninchen
(39), (2)
Konjugat Dieser STXBP2 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Western Blotting (WB)
(36), (21), (9), (7), (5), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-STXBP2 Antikörper

Target Details STXBP2 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 2
Protein Name: Syntaxin-binding protein 2
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
Isotyp IgG

Target Details STXBP2

Produktdetails anti-STXBP2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung STXBP2 (STXBP2 Antibody Abstract)
Hintergrund Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Synonyms: FHL5 antibody|Hunc18b antibody|MUNC18 2 antibody|pp10122 antibody|Protein unc-18 homolog 2 antibody|Protein unc-18 homolog B antibody| STXB2_HUMAN antibody|Stxbp2 antibody|syntaxin binding protein 2 antibody|Syntaxin-binding protein 2 antibody|Unc-18B antibody|UNC18 2 antibody|Unc18-2 antibody|UNC18B antibody
Gen-ID 6813
UniProt Q15833
Pathways Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis


Produktdetails anti-STXBP2 Antikörper Target Details STXBP2 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-STXBP2 Antikörper Target Details STXBP2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Produktdetails anti-STXBP2 Antikörper Target Details STXBP2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Syntaxin Binding Protein 2 (STXBP2) (AA 184-215), (N-Term) antibody (ABIN3043304) anti-Syntaxin Binding Protein 2 (STXBP2) (AA 184-215), (N-Term) antibody