anti-Human Slit Homolog 2 (Drosophila) Antikörper für Immunohistochemistry

Recommended Slit Homolog 2 (Drosophila) Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Slit Homolog 2 (Drosophila) (SLIT2) Antikörper
  • SLIL3
  • Slit-2
  • Drad-1
  • E030015M03Rik
  • E130320P19Rik
  • Slil3
  • mKIAA4141
  • Slit
  • slil3
  • slit-2
  • slit2-a
  • SLIT2
  • slit homolog 2 (Drosophila)
  • slit (Drosophila) homolog 2
  • slit homolog 2
  • SLIT2
  • Slit2
  • slit2
Reaktivität
Human
99
68
36
3
3
2
2
1
1
1
1
1
Wirt
Kaninchen
68
26
17
3
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
9
6
4
4
4
4
4
3
3
2
2
2
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
46
39
37
29
24
13
6
5
5
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4354558
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.452184 ABIN269896 ELISA IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
9.452184 ABIN2466279 IHC ELISA Goat Internal Region Anmelden zum Anzeigen Polyclonal
9.452184 ABIN4354559 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.452184 ABIN2433875 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.452184 ABIN2427269 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN251500 IHC (p) IHC ELISA Goat Anmelden zum Anzeigen Polyclonal 1
1 ABIN4354560 IHC IHC (p) IP WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN185654 IHC ELISA Goat Internal Region Anmelden zum Anzeigen Polyclonal 1
1 ABIN1860579 ICC IHC IP WB Rabbit IgG AA 1416-1528 Anmelden zum Anzeigen Polyclonal
1 ABIN1173398 ICC IHC IP WB Rabbit IgG AA 1160-1333 Anmelden zum Anzeigen Polyclonal
1 ABIN2559994 IHC ELISA Goat IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN4354555 IHC IHC (p) Rabbit IgG C-Term Anmelden zum Anzeigen SP122
1 ABIN4354556 IHC IHC (p) Rabbit IgG C-Term Anmelden zum Anzeigen SP122
1 ABIN4354557 IHC IHC (p) Rabbit IgG C-Term Anmelden zum Anzeigen SP122
1 ABIN1173400 IHC ELISA WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2362506 IHC ELISA Alkaline Phosphatase (AP) Goat Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2362509 IHC ELISA Biotin Goat Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2362507 IHC ELISA APC Goat Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2362512 IHC ELISA PE Goat Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2362510 IHC ELISA FITC Goat Internal Region Anmelden zum Anzeigen Polyclonal

General

Antigen Slit Homolog 2 (Drosophila) (SLIT2) Antikörper
Reaktivität Human
(99), (68), (36), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(68), (26), (17), (3), (2)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(9), (6), (4), (4), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(46), (39), (37), (29), (24), (13), (6), (5), (5), (2), (2), (1)
Pubmed 3 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung Slit2 (SLIT2 Antibody Abstract)
Hintergrund Gene Symbol: SLIT2
Gen-ID 9353
Forschungsgebiet Neurology
Pathways Regulation of Actin Filament Polymerization, Regulation of Cell Size, Smooth Muscle Cell Migration

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Beggs, Jones, Shepherd, Arnaout, Finlayson, Abulafi, Morton, Matthews, Hodgson, Tomlinson: "Loss of expression and promoter methylation of SLIT2 are associated with sessile serrated adenoma formation." in: PLoS genetics, Vol. 9, Issue 5, pp. e1003488, 2013

Brantley-Sieders, Dunaway, Rao, Short, Hwang, Gao, Li, Jiang, Shyr, Wu, Chen: "Angiocrine factors modulate tumor proliferation and motility through EphA2 repression of Slit2 tumor suppressor function in endothelium." in: Cancer research, Vol. 71, Issue 3, pp. 976-87, 2011

Yu, Cao, Yu, Wu, Dallol, Li, Chen, Grasso, Cao, Lonigro, Varambally, Mehra, Palanisamy, Wu, Latif, Chinnaiyan: "The neuronal repellent SLIT2 is a target for repression by EZH2 in prostate cancer." in: Oncogene, Vol. 29, Issue 39, pp. 5370-80, 2010

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Slit Homolog 2 (Drosophila) (SLIT2) antibody (ABIN4354558) Immunohistochemistry: Slit2 Antibody [NBP1-80742] - Staining of human stomach shows s...