anti-Human Scinderin Antikörper für Immunohistochemistry

Recommended Scinderin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Scinderin (SCIN) Antikörper
  • MGC81993
  • si:ch211-134n17.3
  • AW545522
  • adseverin
  • Scind
  • scinderin
  • scin
  • SCIN
  • LOC100225491
  • Scin
Reaktivität
Human
16
4
4
Wirt
Kaninchen
14
2
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
6
5
5
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4352226
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4352225 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1092023 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1092024 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2975308 IF/ICC IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2151194 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Scinderin (SCIN) Antikörper
Reaktivität Human
(16), (4), (4)
Wirt Kaninchen
(14), (2)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(14), (6), (5), (5), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHG
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SCIN (SCIN Antibody Abstract)
Hintergrund Gene Symbol: SCIN
Gen-ID 85477
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Scinderin (SCIN) antibody (ABIN4352226) Western Blot: SCIN Antibody [NBP1-89230] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Scinderin (SCIN) antibody (ABIN4352226) Immunohistochemistry-Paraffin: SCIN Antibody [NBP1-89230] - Staining of human kidney ...
Western Blotting (WB) image for anti-Scinderin (SCIN) antibody (ABIN4352226) Western Blot: SCIN Antibody [NBP1-89230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Scinderin (SCIN) antibody (ABIN4352226) Immunocytochemistry/Immunofluorescence: SCIN Antibody [NBP1-89230] - Staining of huma...