anti-Human FHOD3 Antikörper für Western Blotting

Recommended FHOD3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • zgc:103746
  • formin homology 2 domain containing 3
  • zgc:103746
  • FHOD3
  • Fhod3
Epitop
C-Term
2
Reaktivität
Human
8
3
3
3
3
3
3
Wirt
Kaninchen
8
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
7
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN630729
$ 473.93
Zzgl. Versandkosten $45.00

General

Antigen Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
Epitop C-Term
(2)
Reaktivität Human
(8), (3), (3), (3), (3), (3), (3)
Wirt Kaninchen
(8)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(7), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FHOD3 Antikörper

Target Details FHOD3 Anwendungsinformationen Handhabung Bilder
Spezifität FHOD3 antibody was raised against the C terminal of FHOD3
Reinigung Affinity purified
Immunogen FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV

Target Details FHOD3

Produktdetails anti-FHOD3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FHOD3 (FHOD3 Antibody Abstract)
Hintergrund Proteins that contain formin homology (FH) domains, such as FHOD3, play a role in regulation of the actin cytoskeleton.
Molekulargewicht 60 kDa (MW of target protein)
Forschungsgebiet Cell Biology
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Handhabung Bilder zurück nach oben
Applikationshinweise WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FHOD3 Blocking Peptide, catalog no. 33R-8468, is also available for use as a blocking control in assays to test for specificity of this FHOD3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHOD3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Immunohistochemistry (IHC) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Western Blotting (WB) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody used at 1 ug/ml to detect target protein.