anti-Human FHOD3 Antikörper für Immunohistochemistry

Recommended FHOD3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • zgc:103746
  • formin homology 2 domain containing 3
  • zgc:103746
  • FHOD3
  • Fhod3
Reaktivität
Human
8
3
3
3
3
3
3
Wirt
Kaninchen
8
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4311640
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
8.869417 ABIN630729 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4311639 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2266992 IHC Rabbit IgG AA 1250-1300 Anmelden zum Anzeigen Polyclonal

General

Antigen Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
Reaktivität Human
(8), (3), (3), (3), (3), (3), (3)
Wirt Kaninchen
(8)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (3), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FHOD3 Antikörper

Target Details FHOD3 Anwendungsinformationen Handhabung Referenzen für anti-FHOD3 Antikörper (ABIN4311640) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEAGRTQQEAEAVASLATRISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPNDKVPETAPVQPKTESDYIWDQLM
Isotyp IgG

Target Details FHOD3

Produktdetails anti-FHOD3 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-FHOD3 Antikörper (ABIN4311640) Bilder zurück nach oben
Antigen
Andere Bezeichnung FHOD3 (FHOD3 Antibody Abstract)
Hintergrund Gene Symbol: FHOD3
Gen-ID 80206
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Handhabung Referenzen für anti-FHOD3 Antikörper (ABIN4311640) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Referenzen für anti-FHOD3 Antikörper (ABIN4311640) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-FHOD3 Antikörper (ABIN4311640)

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Wooten, Hebl, Wolf, Greytak, Orr, Draper, Calvino, Kapur, Maron, Kullo, Ommen, Bos, Ackerman, Huggins: "Formin homology 2 domain containing 3 variants associated with hypertrophic cardiomyopathy." in: Circulation. Cardiovascular genetics, Vol. 6, Issue 1, pp. 10-8, 2013 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Handhabung Referenzen für anti-FHOD3 Antikörper (ABIN4311640) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311640) Immunohistochemistry: FHOD3 Antibody [NBP1-83899] - Staining of human urinary bladder...