anti-Human FHOD3 Antikörper für Immunofluorescence

Recommended FHOD3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • zgc:103746
  • formin homology 2 domain containing 3
  • zgc:103746
  • FHOD3
  • Fhod3
Reaktivität
Human
8
3
3
3
3
3
3
Wirt
Kaninchen
8
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4311639
Preis und Verfügbarkeit auf Anfrage.

General

Antigen Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
Reaktivität Human
(8), (3), (3), (3), (3), (3), (3)
Wirt Kaninchen
(8)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FHOD3 Antikörper

Target Details FHOD3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Isotyp IgG

Target Details FHOD3

Produktdetails anti-FHOD3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FHOD3 (FHOD3 Antibody Abstract)
Hintergrund Gene Symbol: FHOD3
Gen-ID 80206
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunocytochemistry/Immunofluorescence: FHOD3 Antibody [NBP1-83898] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunohistochemistry-Paraffin: FHOD3 Antibody [NBP1-83898] Staining of human cerebral...